Property Summary

NCBI Gene PubMed Count 24
PubMed Score 20.56
PubTator Score 21.81

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Mammary Neoplasms 410
Disease Target Count P-value
glioblastoma 5572 2.72961468318817E-8
atypical teratoid / rhabdoid tumor 4369 1.97986736938227E-7
medulloblastoma, large-cell 6234 6.14112012969694E-6
osteosarcoma 7933 3.03597135135211E-5
adult high grade glioma 2148 5.8489491417178E-5
pilocytic astrocytoma 3086 6.84603878476088E-5
medulloblastoma 1524 3.12718213773691E-4
psoriasis 6685 4.98557827100381E-4
astrocytic glioma 2241 9.55229819021224E-4
oligodendroglioma 2849 9.55377810738847E-4
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00124630721652212
ovarian cancer 8492 0.00316282981727429
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00381780466112968
ependymoma 2514 0.00613680563424043
gastric cancer 436 0.0108145389387882
Disease Target Count Z-score Confidence
Breast cancer 3099 3.04 1.5

Synonym

Accession Q9Y4L5 A8K3Y4 Q5T2V9 Q7Z2J2
Symbols BCA2
ZNF364

Gene

  Ortholog (9)

Gene RIF (16)

PMID Text
24852021 BCA2 functions as an antiviral factor that targets HIV-1 Gag for degradation, impairing virus assembly and release.
24852021 Increased levels of ubiquitinated BCA2 are found in the presence of HIV-1 Gag, suggesting that the auto-ubiquitination activity of BCA2 increases in the absence of target proteins
24852021 Knockdown of BCA2 by shRNA enhances HIV-1 replication in Jurkat CD4+ T cells
24403860 BCA2 is an endogenous inhibitor of AMPK activation in breast cancer cells and BCA2 inhibition increases the efficacy of metformin.
24027428 BCA2, a potential oncogenic E3 ubiquitin ligase, promotes breast cancer cell proliferation partially through targeting p21 for ubiquitination and proteasomal degradation.
23418353 RNF126 and Rabring7 play a role in the ubiquitin-dependent sorting and downregulation of membrane receptors.
23242606 High BCA2 expression is associated with renal oncocytoma.
22850893 BCA2 is therefore a newly identified transcriptional target of estrogen receptor.
22844532 Rabring7 stimulates c-Myc degradation via mono-ubiquitination of MM-1
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
More...

AA Sequence

MAEASAAGADSGAAVAAHRFFCHFCKGEVSPKLPEYICPRCESGFIEEVTDDSSFLGGGGSRIDNTTTTH      1 - 70
FAELWGHLDHTMFFQDFRPFLSSSPLDQDNRANERGHQTHTDFWGARPPRLPLGRRYRSRGSSRPDRSPA     71 - 140
IEGILQHIFAGFFANSAIPGSPHPFSWSGMLHSNPGDYAWGQTGLDAIVTQLLGQLENTGPPPADKEKIT    141 - 210
SLPTVTVTQEQVDMGLECPVCKEDYTVEEEVRQLPCNHFFHSSCIVPWLELHDTCPVCRKSLNGEDSTRQ    211 - 280
SQSTEASASNRFSNDSQLHDRWTF                                                  281 - 304
//

Text Mined References (26)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24852021 2014 BCA2/Rabring7 targets HIV-1 Gag for lysosomal degradation in a tetherin-independent manner.
24403860 2013 Regulation of metformin response by breast cancer associated gene 2.
24027428 2013 RNF115/BCA2 E3 ubiquitin ligase promotes breast cancer cell proliferation through targeting p21Waf1/Cip1 for ubiquitin-mediated degradation.
23962720 2014 A genome-wide association study and biological pathway analysis of epilepsy prognosis in a prospective cohort of newly treated epilepsy.
23418353 2013 The E3 ubiquitin ligases RNF126 and Rabring7 regulate endosomal sorting of the epidermal growth factor receptor.
23242606 2013 BCA2 is differentially expressed in renal oncocytoma: an analysis of 158 renal neoplasms.
22850893 2012 Transcriptional activation of breast cancer-associated gene 2 by estrogen receptor.
22844532 2012 Rabring7 degrades c-Myc through complex formation with MM-1.
21516116 2011 Next-generation sequencing to generate interactome datasets.
More...