Property Summary

NCBI Gene PubMed Count 25
PubMed Score 25.69
PubTator Score 21.81

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
adult high grade glioma -1.600 5.8e-05
astrocytic glioma 1.300 9.6e-04
Astrocytoma, Pilocytic -1.100 6.2e-05
atypical teratoid / rhabdoid tumor -1.800 2.0e-07
ependymoma 1.600 6.1e-03
gastric cancer 1.100 1.1e-02
glioblastoma -1.200 7.5e-06
intraductal papillary-mucinous adenoma (... 1.400 1.2e-03
intraductal papillary-mucinous carcinoma... 1.300 3.8e-03
medulloblastoma -1.100 3.1e-04
medulloblastoma, large-cell -1.900 6.1e-06
oligodendroglioma 1.400 9.6e-04
osteosarcoma -1.745 3.0e-05
ovarian cancer 1.100 3.2e-03
psoriasis -1.300 5.0e-04

Gene RIF (17)

AA Sequence

MAEASAAGADSGAAVAAHRFFCHFCKGEVSPKLPEYICPRCESGFIEEVTDDSSFLGGGGSRIDNTTTTH      1 - 70
FAELWGHLDHTMFFQDFRPFLSSSPLDQDNRANERGHQTHTDFWGARPPRLPLGRRYRSRGSSRPDRSPA     71 - 140
IEGILQHIFAGFFANSAIPGSPHPFSWSGMLHSNPGDYAWGQTGLDAIVTQLLGQLENTGPPPADKEKIT    141 - 210
SLPTVTVTQEQVDMGLECPVCKEDYTVEEEVRQLPCNHFFHSSCIVPWLELHDTCPVCRKSLNGEDSTRQ    211 - 280
SQSTEASASNRFSNDSQLHDRWTF                                                  281 - 304
//

Text Mined References (27)

PMID Year Title