Property Summary

NCBI Gene PubMed Count 24
Grant Count 10
R01 Count 5
Funding $391,012.92
PubMed Score 20.56
PubTator Score 21.81

Knowledge Summary

Patent

No data available

Gene RIF (25)

PMID Text
24852021 BCA2 functions as an antiviral factor that targets HIV-1 Gag for degradation, impairing virus assembly and release.
24852021 Increased levels of ubiquitinated BCA2 are found in the presence of HIV-1 Gag, suggesting that the auto-ubiquitination activity of BCA2 increases in the absence of target proteins
24852021 Increased levels of ubiquitinated BCA2 are found in the presence of HIV-1 Gag, suggesting that the auto-ubiquitination activity of BCA2 increases in the absence of target proteins
24852021 Increased levels of ubiquitinated BCA2 are found in the presence of HIV-1 Gag, suggesting that the auto-ubiquitination activity of BCA2 increases in the absence of target proteins
24852021 Increased levels of ubiquitinated BCA2 are found in the presence of HIV-1 Gag, suggesting that the auto-ubiquitination activity of BCA2 increases in the absence of target proteins
24852021 Increased levels of ubiquitinated BCA2 are found in the presence of HIV-1 Gag, suggesting that the auto-ubiquitination activity of BCA2 increases in the absence of target proteins
24852021 Increased levels of ubiquitinated BCA2 are found in the presence of HIV-1 Gag, suggesting that the auto-ubiquitination activity of BCA2 increases in the absence of target proteins
24852021 Increased levels of ubiquitinated BCA2 are found in the presence of HIV-1 Gag, suggesting that the auto-ubiquitination activity of BCA2 increases in the absence of target proteins
24852021 Increased levels of ubiquitinated BCA2 are found in the presence of HIV-1 Gag, suggesting that the auto-ubiquitination activity of BCA2 increases in the absence of target proteins
24852021 Increased levels of ubiquitinated BCA2 are found in the presence of HIV-1 Gag, suggesting that the auto-ubiquitination activity of BCA2 increases in the absence of target proteins
More...

AA Sequence

MAEASAAGADSGAAVAAHRFFCHFCKGEVSPKLPEYICPRCESGFIEEVTDDSSFLGGGGSRIDNTTTTH      1 - 70
FAELWGHLDHTMFFQDFRPFLSSSPLDQDNRANERGHQTHTDFWGARPPRLPLGRRYRSRGSSRPDRSPA     71 - 140
IEGILQHIFAGFFANSAIPGSPHPFSWSGMLHSNPGDYAWGQTGLDAIVTQLLGQLENTGPPPADKEKIT    141 - 210
SLPTVTVTQEQVDMGLECPVCKEDYTVEEEVRQLPCNHFFHSSCIVPWLELHDTCPVCRKSLNGEDSTRQ    211 - 280
SQSTEASASNRFSNDSQLHDRWTF                                                  281 - 304
//

Text Mined References (26)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24852021 2014 BCA2/Rabring7 targets HIV-1 Gag for lysosomal degradation in a tetherin-independent manner.
24403860 2013 Regulation of metformin response by breast cancer associated gene 2.
24027428 2013 RNF115/BCA2 E3 ubiquitin ligase promotes breast cancer cell proliferation through targeting p21Waf1/Cip1 for ubiquitin-mediated degradation.
23962720 2014 A genome-wide association study and biological pathway analysis of epilepsy prognosis in a prospective cohort of newly treated epilepsy.
23418353 2013 The E3 ubiquitin ligases RNF126 and Rabring7 regulate endosomal sorting of the epidermal growth factor receptor.
23242606 2013 BCA2 is differentially expressed in renal oncocytoma: an analysis of 158 renal neoplasms.
22850893 2012 Transcriptional activation of breast cancer-associated gene 2 by estrogen receptor.
22844532 2012 Rabring7 degrades c-Myc through complex formation with MM-1.
21516116 2011 Next-generation sequencing to generate interactome datasets.
More...