Property Summary

NCBI Gene PubMed Count 44
PubMed Score 112.62
PubTator Score 72.77

Knowledge Summary

Patent

No data available

TINX Plot

Expression

  Differential Expression (9)

Disease log2 FC p
juvenile dermatomyositis 1.051 3.1e-11
lung adenocarcinoma 1.304 1.8e-05
lung cancer 1.200 2.3e-03
lung carcinoma 1.400 6.7e-27
malignant mesothelioma 1.100 6.8e-06
Multiple myeloma 1.042 2.6e-03
non-small cell lung cancer 1.002 1.9e-12
ovarian cancer 1.300 2.1e-05
pancreatic ductal adenocarcinoma liver m... -1.515 6.6e-04

Gene RIF (24)

AA Sequence

MADKVRRQRPRRRVCWALVAVLLADLLALSDTLAVMSVDLGSESMKVAIVKPGVPMEIVLNKESRRKTPV      1 - 70
IVTLKENERFFGDSAASMAIKNPKATLRYFQHLLGKQADNPHVALYQARFPEHELTFDPQRQTVHFQISS     71 - 140
QLQFSPEEVLGMVLNYSRSLAEDFAEQPIKDAVITVPVFFNQAERRAVLQAARMAGLKVLQLINDNTATA    141 - 210
LSYGVFRRKDINTTAQNIMFYDMGSGSTVCTIVTYQMVKTKEAGMQPQLQIRGVGFDRTLGGLEMELRLR    211 - 280
ERLAGLFNEQRKGQRAKDVRENPRAMAKLLREANRLKTVLSANADHMAQIEGLMDDVDFKAKVTRVEFEE    281 - 350
LCADLFERVPGPVQQALQSAEMSLDEIEQVILVGGATRVPRVQEVLLKAVGKEELGKNINADEAAAMGAV    351 - 420
YQAAALSKAFKVKPFVVRDAVVYPILVEFTREVEEEPGIHSLKHNKRVLFSRMGPYPQRKVITFNRYSHD    421 - 490
FNFHINYGDLGFLGPEDLRVFGSQNLTTVKLKGVGDSFKKYPDYESKGIKAHFNLDESGVLSLDRVESVF    491 - 560
ETLVEDSAEEESTLTKLGNTISSLFGGGTTPDAKENGTDTVQEEEESPAEGSKDEPGEQVELKEEAEAPV    561 - 630
EDGSQPPPPEPKGDATPEGEKATEKENGDKSEAQKPSEKAEAGPEGVAPAPEGEKKQKPARKRRMVEEIG    631 - 700
VELVVLDLPDLPEDKLAQSVQKLQDLTLRDLEKQEREKAANSLEAFIFETQDKLYQPEYQEVSTEEQREE    701 - 770
ISGKLSAASTWLEDEGVGATTVMLKEKLAELRKLCQGLFFRVEERKKWPERLSALDNLLNHSSMFLKGAR    771 - 840
LIPEMDQIFTEVEMTTLEKVINETWAWKNATLAEQAKLPATEKPVLLSKDIEAKMMALDREVQYLLNKAK    841 - 910
FTKPRPRPKDKNGTRAEPPLNASASDQGEKVIPPAGQTEDAEPISEPEKVETGSEPGDTEPLELGGPGAE    911 - 980
PEQKEQSTGQKRPLKNDEL                                                       981 - 999
//

Text Mined References (52)

PMID Year Title