Property Summary

NCBI Gene PubMed Count 23
PubMed Score 56.88
PubTator Score 8.51

Knowledge Summary

Patent (7,150)

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
pilocytic astrocytoma 3086 9.16973439857114E-6
lung adenocarcinoma 2714 3.21127087914062E-5
psoriasis 6685 7.32971842049599E-5
Down syndrome 548 5.86006982126965E-4
lung cancer 4473 6.60699611603315E-4
group 3 medulloblastoma 2254 0.00153337929726833
Pick disease 1893 0.00568553853924609
progressive supranuclear palsy 674 0.00747744715268035
atypical teratoid / rhabdoid tumor 4369 0.00777883918529191
ovarian cancer 8492 0.00825445985640589
aldosterone-producing adenoma 664 0.011361699521234
oligodendroglioma 2849 0.0125056449859073
astrocytic glioma 2241 0.0178392974961379
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0216351519851657
spina bifida 1064 0.0380442960720115
Disease Target Count Z-score Confidence
Dysgraphia 3 4.398 2.2

Synonym

Accession Q9Y4K4 Q8IYF6
Symbols KHS
GCKR
KHS1
MAPKKKK5

Gene

  Ortholog (10)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA Inparanoid
Zebrafish OMA Inparanoid

  TechDev Info (1)

Gary Johnson Kinome profile via MIB/MS Technology

 GWAS Trait (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448

Gene RIF (3)

PMID Text
27023625 MAP4K5 expression is decreased or lost in majority of pancreatic ductal adenocarcinoma.
16699725 The -822G/A polymorphism in the promoter region of the MAP4K5 gene is associated with reduced risk of type 2 diabetes in Han Chinese from Shanghai.
12591926 TNF signaling leads to oligomerization, ubiquitination, and activation of GCKR and activation of the SAPK pathway in a manner that depends upon TRAF2 polyubiquitination and oligomerization and Ubc13 function

AA Sequence

MEAPLRPAADILRRNPQQDYELVQRVGSGTYGDVYKARNVHTGELAAVKIIKLEPGDDFSLIQQEIFMVK      1 - 70
ECKHCNIVAYFGSYLSREKLWICMEYCGGGSLQDIYHVTGPLSELQIAYVCRETLQGLAYLHTKGKMHRD     71 - 140
IKGANILLTDHGDVKLADFGVAAKITATIAKRKSFIGTPYWMAPEVAAVEKNGGYNQLCDIWAVGITAIE    141 - 210
LGELQPPMFDLHPMRALFLMSKSNFQPPKLKDKTKWSSTFHNFVKIALTKNPKKRPTAERLLTHTFVAQP    211 - 280
GLSRALAVELLDKVNNPDNHAHYTEADDDDFEPHAIIRHTIRSTNRNARAERTASEINFDKLQFEPPLRK    281 - 350
ETEARDEMGLSSDPNFMLQWNPFVDGANTGKSTSKRAIPPPLPPKPRISSYPEDNFPDEEKASTIKHCPD    351 - 420
SESRAPQILRRQSSPSCGPVAETSSIGNGDGISKLMSENTEGSAQAPQLPRKNDKRDFPKPAINGLPPTP    421 - 490
KVLMGACFSKVFDGCPLKINCATSWIHPDTKDQYIIFGTEDGIYTLNLNELHEATMEQLFPRKCTWLYVI    491 - 560
NNTLMSLSEGKTFQLYSHNLIALFEHAKKPGLAAHIQTHRFPDRILPRKFALTTKIPDTKGCHKCCIVRN    561 - 630
PYTGHKYLCGALQSGIVLLQWYEPMQKFMLIKHFDFPLPSPLNVFEMLVIPEQEYPMVCVAISKGTESNQ    631 - 700
VVQFETINLNSASSWFTEIGAGSQQLDSIHVTQLERDTVLVCLDKFVKIVNLQGKLKSSKKLASELSFDF    701 - 770
RIESVVCLQDSVLAFWKHGMQGKSFKSDEVTQEISDETRVFRLLGSDRVVVLESRPTENPTAHSNLYILA    771 - 840
GHENSY                                                                    841 - 846
//

Text Mined References (27)

PMID Year Title
27023625 2016 Prognostic and Functional Significance of MAP4K5 in Pancreatic Cancer.
24925725 2014 Lupus nephritis susceptibility loci in women with systemic lupus erythematosus.
24347629 2014 Genome-wide association study of periodontal health measured by probing depth in adults ages 18-49 years.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21706016 2011 Selected reaction monitoring mass spectrometry reveals the dynamics of signaling through the GRB2 adaptor.
20936779 2010 A human MAP kinase interactome.
20125193 2010 Common genetic variation and performance on standardized cognitive tests.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19380743 2009 Charting the molecular network of the drug target Bcr-Abl.
More...