Property Summary

NCBI Gene PubMed Count 342
Grant Count 318
R01 Count 225
Funding $23,617,471.49
PubMed Score 438.13
PubTator Score 291.02

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
acute myeloid leukemia 2.100 0.048

Synonym

Accession Q9Y4K3 A6NKI7 A8KAB3 D3DR16 Q8NEH5
Symbols RNF85
MGC:3310

Gene

PANTHER Protein Class (1)

PDB

1LB5   1LB4   1LB6   2ECI   2JMD   3HCS   3HCT   3HCU   4Z8M  

Gene RIF (210)

PMID Text
26647777 DAT stabilized IkBa by inhibiting the phosphorylation of Ika by the IkB kinase (IKK) complex. DAT induced proteasomal degradation of TRAF6, and DAT suppressed IKKb-phosphorylation through downregulation of TRAF6
26627263 The expression of TRAF6 was positively correlated with an advanced N stage and acted as a predictor of a poor prognosis in patients with gastric cancer
26582220 TRAF6 may be involved in cell migration, invasion, and apoptosis of SPC-A-1 cells, possibly through regulating the NF-B-CD24/CXCR4 pathway..
26458771 TIFAB loss increases TRAF6 protein and the dynamic range of TLR4 signaling
26456228 These findings suggest that RNF166 positively regulates RNA virus-triggered IFN-beta production by enhancing the ubiquitination of TRAF3 and TRAF6.
26432169 DK1 inhibits the formation of the TAK1-TAB2-TRAF6 complex and leads to the inhibition of TRAF6 ubiquitination.
26385923 Transmembrane motif T6BM2-mediated TRAF6 binding is required for MAVS-related antiviral response.
26334396 These findings suggest that TRAF6 is required for BLyS-mediated NF-kappaB signaling in myeloma cells
26320176 Identify miR-146b-5p as a tumor suppressor and novel prognostic biomarker of gliomas, and suggest miR-146b-5p and TRAF6 as potential therapeutic candidates for malignant gliomas.
26223916 Findings show that TRAF6 is involved in regulating HUVECs proliferation after intermittent hypoxia by modulating cell signaling downstream of AT1R which can be helpful in treating cardiovascular disorders for instance.
More...

AA Sequence

MSLLNCENSCGSSQSESDCCVAMASSCSAVTKDDSVGGTASTGNLSSSFMEEIQGYDVEFDPPLESKYEC      1 - 70
PICLMALREAVQTPCGHRFCKACIIKSIRDAGHKCPVDNEILLENQLFPDNFAKREILSLMVKCPNEGCL     71 - 140
HKMELRHLEDHQAHCEFALMDCPQCQRPFQKFHINIHILKDCPRRQVSCDNCAASMAFEDKEIHDQNCPL    141 - 210
ANVICEYCNTILIREQMPNHYDLDCPTAPIPCTFSTFGCHEKMQRNHLARHLQENTQSHMRMLAQAVHSL    211 - 280
SVIPDSGYISEVRNFQETIHQLEGRLVRQDHQIRELTAKMETQSMYVSELKRTIRTLEDKVAEIEAQQCN    281 - 350
GIYIWKIGNFGMHLKCQEEEKPVVIHSPGFYTGKPGYKLCMRLHLQLPTAQRCANYISLFVHTMQGEYDS    351 - 420
HLPWPFQGTIRLTILDQSEAPVRQNHEEIMDAKPELLAFQRPTIPRNPKGFGYVTFMHLEALRQRTFIKD    421 - 490
DTLLVRCEVSTRFDMGSLRREGFQPRSTDAGV                                          491 - 522
//

Text Mined References (351)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
27107012 2016 Pooled-matrix protein interaction screens using Barcode Fusion Genetics.
26647777 2016 Diallyl trisulfide induces apoptosis by suppressing NF-?B signaling through destabilization of TRAF6 in primary effusion lymphoma.
26627263 2016 TRAF6 promotes the invasion and metastasis and predicts a poor prognosis in gastric cancer.
26582220 2015 [Effect of TRAF6 Downregulation on Malignant Biological Behavior of?Lung Cancer Cell Lines].
26458771 2015 Loss of Tifab, a del(5q) MDS gene, alters hematopoiesis through derepression of Toll-like receptor-TRAF6 signaling.
26456228 2015 Ring finger protein 166 potentiates RNA virus-induced interferon-? production via enhancing the ubiquitination of TRAF3 and TRAF6.
26432169 2015 Phosphoinositide-dependent kinase-1 inhibits TRAF6 ubiquitination by interrupting the formation of TAK1-TAB2 complex in TLR4 signaling.
26385923 2015 Structural Insights into mitochondrial antiviral signaling protein (MAVS)-tumor necrosis factor receptor-associated factor 6 (TRAF6) signaling.
26334396 2015 TRAF6 is required for BLyS-mediated NF-?B signaling in multiple myeloma cells.
More...