Property Summary

NCBI Gene PubMed Count 20
Grant Count 567
R01 Count 352
Funding $54,810,548.52
PubMed Score 11.82
PubTator Score 108.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.334 0.043
urothelial carcinoma -1.800 0.001
malignant mesothelioma -4.900 0.000
glioblastoma 2.300 0.008
osteosarcoma -2.124 0.001
juvenile dermatomyositis 1.039 0.000
tuberculosis -1.100 0.000
primary pancreatic ductal adenocarcinoma 1.214 0.023
intraductal papillary-mucinous neoplasm ... 1.200 0.042
lung cancer -1.600 0.001
interstitial cystitis -1.900 0.000
adult high grade glioma 1.900 0.001
pilocytic astrocytoma 3.200 0.000
posterior fossa group A ependymoma 1.200 0.000
subependymal giant cell astrocytoma 1.585 0.021
Breast cancer -1.600 0.000
lung carcinoma -2.400 0.000
spina bifida -1.560 0.037
ovarian cancer 1.300 0.007
pituitary cancer 2.000 0.003
pancreatic cancer 1.100 0.021

Synonym

Accession Q9Y4K1 B4DU04 O00296 Q5VWJ2
Symbols ST4
CRYBG1

Gene

PDB

2DAD   3CW3  

 GO Function (1)

 Compartment GO Term (0)

Gene RIF (9)

PMID Text
24094292 Both DNMT1 and AIM1 show maternal allele-specific methylation and paternal allele-specific transcription.
22761906 AIM1, ERGIC1, and TPX2 were shown to be highly expressed especially in prostate cancer tissues, and high mRNA expression of ERGIC1 and TMED3 associated with AR and ERG oncogene expression
22402438 AIM1 promoter hypermethylation was found in higher frequency (P = 0.005) in metastatic melanoma (65%) than in primary melanomas (38%).
22127895 Methylation status of AIM1 in the prostate cancer specimen may predict for time to recurrence in Gleason 3 + 4 = 7 patients undergoing prostatectomy.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19910543 Observational study of gene-disease association. (HuGE Navigator)
19194464 tumor-promoting effect of deletion in 6q21, that included genes PRDM1, ATG5 and AIM1
18582473 Absent in melanoma 1 (AIM1), an unusual member of the superfamily , contains 12 betagamma-crystallin motifs in six domains. Some of these motifs diverge considerably from the canonical motif sequence. AIM1g1, the first betagamma-crystallin domain of AIM1.
16511323 the structure of AIM1g1, a single betagamma-crystallin domain from the protein absent in melanoma 1, was determined

AA Sequence

MEKRSSGRRSGRRRGSQKSTDSPGADAELPESAARDDAVFDDEVAPNAASDNASAEKKVKSPRAALDGGV      1 - 70
ASAASPESKPSPGTKGQLRGESDRSKQPPPASSPTKRKGRSRALEAVPAPPASGPRAPAKESPPKRVPDP     71 - 140
SPVTKGTAAESGEEAARAIPRELPVKSSSLLPEIKPEHKRGPLPNHFNGRAEGGRSRELGRAAGAPGASD    141 - 210
ADGLKPRNHFGVGRSTVTTKVTLPAKPKHVELNLKTPKNLDSLGNEHNPFSQPVHKGNTATKISLFENKR    211 - 280
TNSSPRHTDIRGQRNTPASSKTFVGRAKLNLAKKAKEMEQPEKKVMPNSPQNGVLVKETAIETKVTVSEE    281 - 350
EILPATRGMNGDSSENQALGPQPNQDDKADVQTDAGCLSEPVASALIPVKDHKLLEKEDSEAADSKSLVL    351 - 420
ENVTDTAQDIPTTVDTKDLPPTAMPKPQHTFSDSQSPAESSPGPSLSLSAPAPGDVPKDTCVQSPISSFP    421 - 490
CTDLKVSENHKGCVLPVSRQNNEKMPLLELGGETTPPLSTERSPEAVGSECPSRVLVQVRSFVLPVESTQ    491 - 560
DVSSQVIPESSEVREVQLPTCHSNEPEVVSVASCAPPQEEVLGNEHSHCTAELAAKSGPQVIPPASEKTL    561 - 630
PIQAQSQGSRTPLMAESSPTNSPSSGNHLATPQRPDQTVTNGQDSPASLLNISAGSDDSVFDSSSDMEKF    631 - 700
TEIIKQMDSAVCMPMKRKKARMPNSPAPHFAMPPIHEDHLEKVFDPKVFTFGLGKKKESQPEMSPALHLM    701 - 770
QNLDTKSKLRPKRASAEQSVLFKSLHTNTNGNSEPLVMPEINDKENRDVTNGGIKRSRLEKSALFSSLLS    771 - 840
SLPQDKIFSPSVTSVNTMTTAFSTSQNGSLSQSSVSQPTTEGAPPCGLNKEQSNLLPDNSLKVFNFNSSS    841 - 910
TSHSSLKSPSHMEKYPQKEKTKEDLDSRSNLHLPETKFSELSKLKNDDMEKANHIESVIKSNLPNCANSD    911 - 980
TDFMGLFKSSRYDPSISFSGMSLSDTMTLRGSVQNKLNPRPGKVVIYSEPDVSEKCIEVFSDIQDCSSWS    981 - 1050
LSPVILIKVVRGCWILYEQPNFEGHSIPLEEGELELSGLWGIEDILERHEEAESDKPVVIGSIRHVVQDY   1051 - 1120
RVSHIDLFTEPEGLGILSSYFDDTEEMQGFGVMQKTCSMKVHWGTWLIYEEPGFQGVPFILEPGEYPDLS   1121 - 1190
FWDTEEAYIGSMRPLKMGGRKVEFPTDPKVVVYEKPFFEGKCVELETGMCSFVMEGGETEEATGDDHLPF   1191 - 1260
TSVGSMKVLRGIWVAYEKPGFTGHQYLLEEGEYRDWKAWGGYNGELQSLRPILGDFSNAHMIMYSEKNFG   1261 - 1330
SKGSSIDVLGIVANLKETGYGVKTQSINVLSGVWVAYENPDFTGEQYILDKGFYTSFEDWGGKNCKISSV   1331 - 1400
QPICLDSFTGPRRRNQIHLFSEPQFQGHSQSFEETTSQIDDSFSTKSCRVSGGSWVVYDGENFTGNQYVL   1401 - 1470
EEGHYPCLSAMGCPPGATFKSLRFIDVEFSEPTIILFEREDFKGKKIELNAETVNLRSLGFNTQIRSVQV   1471 - 1540
IGGIWVTYEYGSYRGRQFLLSPAEVPNWYEFSGCRQIGSLRPFVQKRIYFRLRNKATGLFMSTNGNLEDL   1541 - 1610
KLLRIQVMEDVGADDQIWIYQEGCIKCRIAEDCCLTIVGSLVTSGSKLGLALDQNADSQFWSLKSDGRIY   1611 - 1680
SKLKPNLVLDIKGGTQYDQNHIILNTVSKEKFTQVWEAMVLYT                              1681 - 1723
//

Text Mined References (26)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24094292 2013 DNMT1 and AIM1 Imprinting in human placenta revealed through a genome-wide screen for allele-specific DNA methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22761906 2012 High-throughput transcriptomic and RNAi analysis identifies AIM1, ERGIC1, TMED3 and TPX2 as potential drug targets in prostate cancer.
22402438 2012 AIM1 and LINE-1 epigenetic aberrations in tumor and serum relate to melanoma progression and disease outcome.
22127895 2012 AIM1 promoter hypermethylation as a predictor of decreased risk of recurrence following radical prostatectomy.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21269460 2011 Initial characterization of the human central proteome.
20834067 2010 Joint influence of small-effect genetic variants on human longevity.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
More...