Property Summary

NCBI Gene PubMed Count 83
PubMed Score 173.00
PubTator Score 80.38

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (5)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
Disease Target Count Z-score Confidence
Cancer 2499 3.31 1.7

Expression

  Differential Expression (29)

Disease log2 FC p
adrenocortical carcinoma 1.419 1.8e-04
adult high grade glioma 1.600 6.7e-03
Astrocytoma, Pilocytic 2.100 2.5e-06
atypical teratoid / rhabdoid tumor 2.300 1.7e-04
Becker muscular dystrophy 1.105 2.4e-03
Breast cancer 1.200 8.3e-04
cystic fibrosis 2.100 2.1e-03
cystic fibrosis and chronic rhinosinusit... 1.175 2.9e-02
Duchenne muscular dystrophy 1.053 1.9e-08
esophageal adenocarcinoma 1.800 1.8e-02
gastric carcinoma 2.100 7.9e-03
Gaucher disease type 3 1.100 3.0e-02
glioblastoma 1.800 3.0e-05
interstitial cystitis 3.100 3.9e-05
juvenile dermatomyositis 1.198 2.0e-08
lung cancer 2.500 3.0e-05
malignant mesothelioma -1.700 1.3e-06
medulloblastoma 1.200 5.9e-03
medulloblastoma, large-cell 1.500 1.9e-03
non-small cell lung cancer 1.675 6.2e-11
osteosarcoma 1.918 1.1e-02
ovarian cancer 1.100 9.0e-06
pancreatic cancer 1.800 1.5e-05
pancreatic ductal adenocarcinoma liver m... 1.473 7.0e-03
Polycystic ovary syndrome -1.457 1.8e-02
posterior fossa group A ependymoma 1.300 1.6e-05
primitive neuroectodermal tumor 1.400 1.1e-02
ulcerative colitis 2.900 2.9e-06
urothelial carcinoma 1.500 2.1e-02

Protein-protein Interaction (2)

Gene RIF (69)

AA Sequence

MERPLCSHLCSCLAMLALLSPLSLAQYDSWPHYPEYFQQPAPEYHQPQAPANVAKIQLRLAGQKRKHSEG      1 - 70
RVEVYYDGQWGTVCDDDFSIHAAHVVCRELGYVEAKSWTASSSYGKGEGPIWLDNLHCTGNEATLAACTS     71 - 140
NGWGVTDCKHTEDVGVVCSDKRIPGFKFDNSLINQIENLNIQVEDIRIRAILSTYRKRTPVMEGYVEVKE    141 - 210
GKTWKQICDKHWTAKNSRVVCGMFGFPGERTYNTKVYKMFASRRKQRYWPFSMDCTGTEAHISSCKLGPQ    211 - 280
VSLDPMKNVTCENGLPAVVSCVPGQVFSPDGPSRFRKAYKPEQPLVRLRGGAYIGEGRVEVLKNGEWGTV    281 - 350
CDDKWDLVSASVVCRELGFGSAKEAVTGSRLGQGIGPIHLNEIQCTGNEKSIIDCKFNAESQGCNHEEDA    351 - 420
GVRCNTPAMGLQKKLRLNGGRNPYEGRVEVLVERNGSLVWGMVCGQNWGIVEAMVVCRQLGLGFASNAFQ    421 - 490
ETWYWHGDVNSNKVVMSGVKCSGTELSLAHCRHDGEDVACPQGGVQYGAGVACSETAPDLVLNAEMVQQT    491 - 560
TYLEDRPMFMLQCAMEENCLSASAAQTDPTTGYRRLLRFSSQIHNNGQSDFRPKNGRHAWIWHDCHRHYH    561 - 630
SMEVFTHYDLLNLNGTKVAEGHKASFCLEDTECEGDIQKNYECANFGDQGITMGCWDMYRHDIDCQWVDI    631 - 700
TDVPPGDYLFQVVINPNFEVAESDYSNNIMKCRSRYDGHRIWMYNCHIGGSFSEETEKKFEHFSGLLNNQ    701 - 770
LSPQ                                                                      771 - 774
//

Text Mined References (87)

PMID Year Title