Property Summary

NCBI Gene PubMed Count 63
PubMed Score 142.01
PubTator Score 80.38

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (28)

Disease log2 FC p
urothelial carcinoma 1.500 2.1e-02
malignant mesothelioma -1.700 1.3e-06
esophageal adenocarcinoma 1.800 1.8e-02
glioblastoma 2.900 3.1e-06
osteosarcoma 1.918 1.1e-02
sonic hedgehog group medulloblastoma 1.900 9.3e-04
atypical teratoid / rhabdoid tumor 2.300 1.7e-04
medulloblastoma, large-cell 1.500 1.9e-03
primitive neuroectodermal tumor 1.400 1.1e-02
Duchenne muscular dystrophy 1.053 1.9e-08
Becker muscular dystrophy 1.105 2.4e-03
juvenile dermatomyositis 1.198 2.0e-08
adrenocortical carcinoma 1.419 1.8e-04
pancreatic ductal adenocarcinoma liver m... 1.473 7.0e-03
non-small cell lung cancer 1.675 6.2e-11
lung cancer 2.500 3.0e-05
pancreatic cancer 1.800 1.5e-05
interstitial cystitis 3.100 3.9e-05
cystic fibrosis 2.100 2.1e-03
pediatric high grade glioma 2.300 4.1e-06
pilocytic astrocytoma 2.100 2.0e-06
posterior fossa group A ependymoma 1.300 1.6e-05
Polycystic Ovary Syndrome -1.457 1.8e-02
gastric carcinoma 2.100 7.9e-03
ulcerative colitis 2.900 2.9e-06
ovarian cancer 2.900 5.9e-05
Breast cancer 1.200 8.3e-04
Gaucher disease type 3 1.100 3.0e-02

Protein-protein Interaction (2)

Gene RIF (52)

PMID Text
26676674 Loss of tumor-suppressive miR29s enhanced cancer cell invasion in lung SCC through direct regulation of oncogenic LOXL2.
26329904 LOXL2 promotes tumor progression.
26206869 We identified LOXL2 to be associated with the outcome of colon cancer patients. Furthermore, it can be used to stratify patients at stages II and III for further therapeutic decisions.
26096783 Data suggest that restoration of MIRN29 (microRNA 29) synthesis silences expression of LOXL2 (lysyl oxidase-like 2) and inhibits cell proliferation, migration, and invasiveness of renal cell carcinoma cells.
25959397 Lysine oxidation of the transcription factor TAF10 by LOXL2 is a controlled protein modification and demonstrates a role for protein oxidation in regulating pluripotency genes.
25759215 LOXL2 is a direct repressor of NOTCH1.There is an exclusive expression pattern between LOXL2 and members of the canonical NOTCH1 pathway in human head and neck squamous cell carcinoma.
25275797 identified novel alternative splicing isoform, LOXL2 Deltae13; data suggest it modulates effects of cancer cell migration and invasion through a different mechanism from full-length LOXL2 and may play an important role in tumor carcinogenesis and progression
25254241 Data indicate potential roles of LOXL2 (lysyl oxidase-like 2) splice variants with large scale data.
25146937 The structure and functions of human lysyl oxidase-like 2 (LOXL2) are reviewed. [review]
25128648 LOXL2 expression in stromal cells may be a useful prognostic factor for patients with gastric cancer. Fibroblast-derived LOXL2 may stimulate the motility of gastric cancer cells.
25092917 Results show that LOXL2 is highly expressed and involved in clear cell renal cell carcinoma progression by regulating the levels of integrins a5 and b1.
25048396 promoted intrahepatic metastasis by increasing tissue stiffness
24863880 LOXL2 activates the FAK/Akt/mTOR signaling pathways and promotes cell proliferation and inhibits apoptotic cell death.
24716982 These results provide important clues for experimental identification of the specific biological roles and molecular mechanisms of LOXL2-delta72.
24177001 higher sLOXL2 levels are associated with increased risk for IPF disease progression
24014025 nuclear associated LOXL2 contributes to the stabilization of Snail1 transcription factor at the protein level to induce EMT and promote invasion in vitro
24008674 Findings reveal new insight into the mechanisms of fibroblast activation, a novel function of LOXL2, and further highlight the importance of generating LOXL2-targeted therapies for the prevention of tumor progression and metastasis.
23971878 LOXL2 expression in normal epithelial cells can induce abnormal changes that resemble oncogenic transformation and cancer progression.
23933800 Higher LOXL2 expression is associated with invasiveness of basal-like breast cancer cells and lower survival of breast cancer patients.
23677379 negative regulator of odontogenic differentiation of dental pulp stem cells
23640157 Sequence analysis of LOXL2, genes did not reveal any putative mutations for hyperostosis cranialis interna to chromosome 8p21
23494965 Data suggest that all members of LOX gene family (lysyl-oxidase [LOX]; lysyl oxidase-like proteins [LOXL1, LOXL2, LOXL3]) are over-expressed in bone marrow in primary myelofibrosis; LOX gene family is not detectable in normal bone marrow.
23357697 TGF-beta1 induced injured MCL to express more LOXs than injured ACL (up to 1.85-fold in LOX, 2.21-fold in LOXL-1, 1.71-fold in LOXL-2, 2.52-fold in LOXL-3 and 3.32-fold in LOXL-4).
23319596 the N-glycan at Asn-644 of hLOXL2 enhances the solubility and stability of the LOX catalytic domain
23030485 Intracellular (perinuclear) expression of LOXL2 is associated with poor prognosis and distant metastasis of specific tumor types. [Review]
22739041 Up-regulation of CCL2, CCL26, IL6 and LOXL2 genes in cancer cells are part of the common effects of cancer-associated fibroblasts on hepatocellular carcinoma cells
22483618 LOXL2 activity is linked with the transcriptional control of CDH1 gene by regulating H3K4me3 deamination.
22204712 These results suggest that lysyl oxidase L2 exerts a critical effect on esophageal squamous cell carcinoma progression and can be a predictive marker of lymph node metastasis and outcome.
21835952 This study provides the first evidence for the role of LOXL2 in regulating angiogenesis through collagen IV scaffolding.
21740577 The human lysyl oxidase-like 2 gene does not confer increased genotypic risk for adolescent idiopathic scoliosis.
21732535 Breast carcinoma cell lines with basal-like phenotype show a specific cytoplasmic/perinuclear LOXL2 expression, and this subcellular distribution is significantly associated with distant metastatic incidence in basal-like breast carcinomas.
21519871 Down-regulation of lysyl oxidase-like 2 is associated with disease progression in lung adenocarcinomas.
21233336 Analysis of a published microarray data set revealed that LOXL2 expression is correlated with metastasis and decreased survival in patients with aggressive breast cancer
20802105 Data show that LOXL2 and RAMP3 are strongly coexpressed in human colon, breast, and gastric carcinomas but not in normal colon or gastric epithelial cells.
20439985 Antibody allosteric modulators of enzymatic function represent a novel drug development strategy and, in the context of LOXL2, suggest that inhibitors such as these might be useful therapeutics in oncology, fibrosis, and inflammation.
20306300 The purified recombinant LOXL2 proteins, with or without the SRCR domains in the N-terminus, showed significant amine oxidase activity toward several different types of collagen and elastin in in vitro amine oxidase assays.
20043065 FOXA1 induces not only KRT7 but also LOXL2 in a subset of poor prognostic esophageal squamous cell carcinomas with metastatic lymph nodes
20026874 molecular pathway from hypoxia to cellular transformation includes up-regulation of HIF and subsequent transcriptional induction of LOX and LOXL2, which repress E-cadherin and induce epithelial to mesenchymal transition
20012301 The improved response toward chemotherapy in LOLX2-silenced pancreatic cancer cells is possibly mediated by the transcription factor E2F5.
19724858 Expression of LOXL, LOXL2, LOXL3 and LOXL4 was not statistically associated with tumor location, stage, growth type, or differentiation status in colorectal adenocarcinomas
19625348 LOXL2 overexpression, a frequent event in gastric carcinoma progression and may be a therapeutic target for preventing and treating metastases.
19394199 Report reciprocal regulation of LOX and LOXL2 expression during cell adhesion and terminal differentiation in epidermal keratinocytes.
19383344 up-regulation in human colorectal cancer is correlated with upregulation of the TIMP-1 transcript
19015874 Breast carcinoma effusions showed significantly higher LOXL2 and lower LOXL3 expression compared to primary carcinomas.
18590575 Increased mRNA expression during progression of colorectal cancer with liver metastases
18559498 High levels of LOXL2 are associated with squamous cell carcinomas
17287949 Observational study of gene-disease association and gene-gene interaction. (HuGE Navigator)
17287949 We detected an empirically significant association with one SNP of LOXL2 in familial IA patients after adjustment for multiple testing [chi(2) = 10.23, empirical P = 0.023, OR (95% CI) = 1.49 (1.17.
16096638 Lysyl-oxidase-like 2 interacts and cooperates with Snail to downregulate E-cadherin expression, and control epithelial-mesenchymal transitions and carcinoma progression.
16023247 The upregulation of Loxl2 in Wilson's disease could perhaps be utilized for diagnostic purposes since their expression is up-regulated in hepatocytes even before the onset of fibrosis.
12820424 No reduction of LOXL2-mRNA levels was found in the malignantly transformed tissues from HNSCC. LOXL2 may play a role in malignant transformation.
12670920 LOR-1 promotes tumor fibrosis and tumor invasiveness simultaneously.

AA Sequence

MERPLCSHLCSCLAMLALLSPLSLAQYDSWPHYPEYFQQPAPEYHQPQAPANVAKIQLRLAGQKRKHSEG      1 - 70
RVEVYYDGQWGTVCDDDFSIHAAHVVCRELGYVEAKSWTASSSYGKGEGPIWLDNLHCTGNEATLAACTS     71 - 140
NGWGVTDCKHTEDVGVVCSDKRIPGFKFDNSLINQIENLNIQVEDIRIRAILSTYRKRTPVMEGYVEVKE    141 - 210
GKTWKQICDKHWTAKNSRVVCGMFGFPGERTYNTKVYKMFASRRKQRYWPFSMDCTGTEAHISSCKLGPQ    211 - 280
VSLDPMKNVTCENGLPAVVSCVPGQVFSPDGPSRFRKAYKPEQPLVRLRGGAYIGEGRVEVLKNGEWGTV    281 - 350
CDDKWDLVSASVVCRELGFGSAKEAVTGSRLGQGIGPIHLNEIQCTGNEKSIIDCKFNAESQGCNHEEDA    351 - 420
GVRCNTPAMGLQKKLRLNGGRNPYEGRVEVLVERNGSLVWGMVCGQNWGIVEAMVVCRQLGLGFASNAFQ    421 - 490
ETWYWHGDVNSNKVVMSGVKCSGTELSLAHCRHDGEDVACPQGGVQYGAGVACSETAPDLVLNAEMVQQT    491 - 560
TYLEDRPMFMLQCAMEENCLSASAAQTDPTTGYRRLLRFSSQIHNNGQSDFRPKNGRHAWIWHDCHRHYH    561 - 630
SMEVFTHYDLLNLNGTKVAEGHKASFCLEDTECEGDIQKNYECANFGDQGITMGCWDMYRHDIDCQWVDI    631 - 700
TDVPPGDYLFQVVINPNFEVAESDYSNNIMKCRSRYDGHRIWMYNCHIGGSFSEETEKKFEHFSGLLNNQ    701 - 770
LSPQ                                                                      771 - 774
//

Text Mined References (66)

PMID Year Title
26676674 2016 Tumor-suppressive microRNA-29 family inhibits cancer cell migration and invasion directly targeting LOXL2 in lung squamous cell carcinoma.
26329904 2015 The function and mechanisms of action of LOXL2 in cancer (Review).
26206869 2015 LOXL2 Is Highly Expressed in Cancer-Associated Fibroblasts and Associates to Poor Colon Cancer Survival.
26096783 2015 Tumour-suppressive microRNA-29s directly regulate LOXL2 expression and inhibit cancer cell migration and invasion in renal cell carcinoma.
25959397 2015 LOXL2 Oxidizes Methylated TAF10 and Controls TFIID-Dependent Genes during Neural Progenitor Differentiation.
25759215 2015 Lysyl oxidase-like 2 represses Notch1 expression in the skin to promote squamous cell carcinoma progression.
25275797 2014 Identification of a novel lysyl oxidase-like 2 alternative splicing isoform, LOXL2 ?e13, in esophageal squamous cell carcinoma.
25254241 2014 Exploration of potential roles of a new LOXL2 splicing variant using network knowledge in esophageal squamous cell carcinoma.
25146937 2014 Human lysyl oxidase-like 2.
25128648 2014 Lysyl oxidase-like 2 (LOXL2) from stromal fibroblasts stimulates the progression of gastric cancer.
25092917 2014 LOXL2 status correlates with tumor stage and regulates integrin levels to promote tumor progression in ccRCC.
25048396 2014 Lysyl oxidase-like 2 is critical to tumor microenvironment and metastatic niche formation in hepatocellular carcinoma.
24863880 2014 Lysyl oxidase-like 2 (LOXL2) controls tumor-associated cell proliferation through the interaction with MARCKSL1.
24716982 2014 Protein-protein interaction network analyses for elucidating the roles of LOXL2-delta72 in esophageal squamous cell carcinoma.
24177001 2014 Serum lysyl oxidase-like 2 levels and idiopathic pulmonary fibrosis disease progression.
24014025 2013 MCF-7 cells expressing nuclear associated lysyl oxidase-like 2 (LOXL2) exhibit an epithelial-to-mesenchymal transition (EMT) phenotype and are highly invasive in vitro.
24008674 2013 Tumor-secreted LOXL2 activates fibroblasts through FAK signaling.
23979707 2013 SILAC-based proteomics of human primary endothelial cell morphogenesis unveils tumor angiogenic markers.
23971878 2013 LOXL2 induces aberrant acinar morphogenesis via ErbB2 signaling.
23933800 2013 LOXL2 expression is associated with invasiveness and negatively influences survival in breast cancer patients.
23677379 2013 The role of lysyl oxidase-like 2 in the odontogenic differentiation of human dental pulp stem cells.
23640157 2013 Localization of the gene for hyperostosis cranialis interna to chromosome 8p21 with analysis of three candidate genes.
23494965 2013 The expression of lysyl-oxidase gene family members in myeloproliferative neoplasms.
23357697 2013 TGF-beta1 induces the different expressions of lysyl oxidases and matrix metalloproteinases in anterior cruciate ligament and medial collateral ligament fibroblasts after mechanical injury.
23319596 2013 Post-translational modifications of recombinant human lysyl oxidase-like 2 (rhLOXL2) secreted from Drosophila S2 cells.
23030485 2012 LOXL2 in epithelial cell plasticity and tumor progression.
22739041 2012 Cancer-associated fibroblasts up-regulate CCL2, CCL26, IL6 and LOXL2 genes related to promotion of cancer progression in hepatocellular carcinoma cells.
22483618 2012 Lysyl oxidase-like 2 deaminates lysine 4 in histone H3.
22204712 2012 Reduced nuclear and ectopic cytoplasmic expression of lysyl oxidase-like 2 is associated with lymph node metastasis and poor prognosis in esophageal squamous cell carcinoma.
22157764 2012 The enzymatic activity of lysyl oxidas-like-2 (LOXL2) is not required for LOXL2-induced inhibition of keratinocyte differentiation.
21835952 2011 Lysyl oxidase-like protein-2 regulates sprouting angiogenesis and type IV collagen assembly in the endothelial basement membrane.
21740577 2011 Common polymorphisms in human lysyl oxidase genes are not associated with the adolescent idiopathic scoliosis phenotype.
21732535 2011 Lysyl oxidase-like 2 (LOXL2), a new regulator of cell polarity required for metastatic dissemination of basal-like breast carcinomas.
21519871 2012 Down-regulation of lysyl oxidase-like 2 (LOXL2) is associated with disease progression in lung adenocarcinomas.
21233336 2011 LOXL2-mediated matrix remodeling in metastasis and mammary gland involution.
20818376 2010 Allosteric inhibition of lysyl oxidase-like-2 impedes the development of a pathologic microenvironment.
20802105 2011 Receptor activity modifying protein-3 mediates the protumorigenic activity of lysyl oxidase-like protein-2.
20732625 2010 Meta-analysis of genome-wide association studies of attention-deficit/hyperactivity disorder.
20439985 2010 Modulation of lysyl oxidase-like 2 enzymatic activity by an allosteric antibody inhibitor.
20306300 2011 The human lysyl oxidase-like 2 protein functions as an amine oxidase toward collagen and elastin.
20043065 2010 Forkhead box A1 transcriptional pathway in KRT7-expressing esophageal squamous cell carcinomas with extensive lymph node metastasis.
20026874 2010 The lysyl oxidases LOX and LOXL2 are necessary and sufficient to repress E-cadherin in hypoxia: insights into cellular transformation processes mediated by HIF-1.
20012301 2010 Functional analysis of LOXL2 in pancreatic carcinoma.
19724858 2009 Differential expression of the LOX family genes in human colorectal adenocarcinomas.
19625348 2009 Secreted LOXL2 is a novel therapeutic target that promotes gastric cancer metastasis via the Src/FAK pathway.
19394199 2009 Reciprocal regulation of LOX and LOXL2 expression during cell adhesion and terminal differentiation in epidermal keratinocytes.
19383344 2008 TIMP-1 expression in human colorectal cancer is associated with TGF-B1, LOXL2, INHBA1, TNF-AIP6 and TIMP-2 transcript profiles.
19015874 2009 Lysyl oxidase-like 4 is alternatively spliced in an anatomic site-specific manner in tumors involving the serosal cavities.
18590575 2008 Metastatic susceptibility locus, an 8p hot-spot for tumour progression disrupted in colorectal liver metastases: 13 candidate genes examined at the DNA, mRNA and protein level.
18559498 2008 Lysyl oxidase-like 2 as a new poor prognosis marker of squamous cell carcinomas.
17287949 2007 Systematic screening of lysyl oxidase-like (LOXL) family genes demonstrates that LOXL2 is a susceptibility gene to intracranial aneurysms.
16421571 2006 DNA sequence and analysis of human chromosome 8.
16096638 2005 A molecular role for lysyl oxidase-like 2 enzyme in snail regulation and tumor progression.
16023247 2005 Abnormal deposition of collagen around hepatocytes in Wilson's disease is associated with hepatocyte specific expression of lysyl oxidase and lysyl oxidase like protein-2.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12820424 Reduction of LOX- and LOXL2-mRNA expression in head and neck squamous cell carcinomas.
12686136 2003 Structural and functional diversity of lysyl oxidase and the LOX-like proteins.
12670920 2003 Lysyl oxidase-related protein-1 promotes tumor fibrosis and tumor progression in vivo.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11642359 2001 Lysyl oxidases: a novel multifunctional amine oxidase family.
11162352 2001 Lysyl oxidases: expression in the fetal membranes and placenta.
10212285 1999 The LOXL2 gene encodes a new lysyl oxidase-like protein and is expressed at high levels in reproductive tissues.
9722957 1998 The human lysyl oxidase-related gene (LOXL2) maps between markers D8S280 and D8S278 on chromosome 8p21.2-p21.3.
9079631 1997 Regulation of a novel gene encoding a lysyl oxidase-related protein in cellular adhesion and senescence.
8125298 1994 Oligo-capping: a simple method to replace the cap structure of eukaryotic mRNAs with oligoribonucleotides.