Property Summary

NCBI Gene PubMed Count 63
Grant Count 13
R01 Count 3
Funding $773,505.63
PubMed Score 142.01
PubTator Score 80.38

Knowledge Summary

Patent

No data available

Expression

Gene RIF (52)

PMID Text
26676674 Loss of tumor-suppressive miR29s enhanced cancer cell invasion in lung SCC through direct regulation of oncogenic LOXL2.
26329904 LOXL2 promotes tumor progression.
26206869 We identified LOXL2 to be associated with the outcome of colon cancer patients. Furthermore, it can be used to stratify patients at stages II and III for further therapeutic decisions.
26096783 Data suggest that restoration of MIRN29 (microRNA 29) synthesis silences expression of LOXL2 (lysyl oxidase-like 2) and inhibits cell proliferation, migration, and invasiveness of renal cell carcinoma cells.
25959397 Lysine oxidation of the transcription factor TAF10 by LOXL2 is a controlled protein modification and demonstrates a role for protein oxidation in regulating pluripotency genes.
25759215 LOXL2 is a direct repressor of NOTCH1.There is an exclusive expression pattern between LOXL2 and members of the canonical NOTCH1 pathway in human head and neck squamous cell carcinoma.
25275797 identified novel alternative splicing isoform, LOXL2 Deltae13; data suggest it modulates effects of cancer cell migration and invasion through a different mechanism from full-length LOXL2 and may play an important role in tumor carcinogenesis and progression
25254241 Data indicate potential roles of LOXL2 (lysyl oxidase-like 2) splice variants with large scale data.
25146937 The structure and functions of human lysyl oxidase-like 2 (LOXL2) are reviewed. [review]
25128648 LOXL2 expression in stromal cells may be a useful prognostic factor for patients with gastric cancer. Fibroblast-derived LOXL2 may stimulate the motility of gastric cancer cells.
More...

AA Sequence

MERPLCSHLCSCLAMLALLSPLSLAQYDSWPHYPEYFQQPAPEYHQPQAPANVAKIQLRLAGQKRKHSEG      1 - 70
RVEVYYDGQWGTVCDDDFSIHAAHVVCRELGYVEAKSWTASSSYGKGEGPIWLDNLHCTGNEATLAACTS     71 - 140
NGWGVTDCKHTEDVGVVCSDKRIPGFKFDNSLINQIENLNIQVEDIRIRAILSTYRKRTPVMEGYVEVKE    141 - 210
GKTWKQICDKHWTAKNSRVVCGMFGFPGERTYNTKVYKMFASRRKQRYWPFSMDCTGTEAHISSCKLGPQ    211 - 280
VSLDPMKNVTCENGLPAVVSCVPGQVFSPDGPSRFRKAYKPEQPLVRLRGGAYIGEGRVEVLKNGEWGTV    281 - 350
CDDKWDLVSASVVCRELGFGSAKEAVTGSRLGQGIGPIHLNEIQCTGNEKSIIDCKFNAESQGCNHEEDA    351 - 420
GVRCNTPAMGLQKKLRLNGGRNPYEGRVEVLVERNGSLVWGMVCGQNWGIVEAMVVCRQLGLGFASNAFQ    421 - 490
ETWYWHGDVNSNKVVMSGVKCSGTELSLAHCRHDGEDVACPQGGVQYGAGVACSETAPDLVLNAEMVQQT    491 - 560
TYLEDRPMFMLQCAMEENCLSASAAQTDPTTGYRRLLRFSSQIHNNGQSDFRPKNGRHAWIWHDCHRHYH    561 - 630
SMEVFTHYDLLNLNGTKVAEGHKASFCLEDTECEGDIQKNYECANFGDQGITMGCWDMYRHDIDCQWVDI    631 - 700
TDVPPGDYLFQVVINPNFEVAESDYSNNIMKCRSRYDGHRIWMYNCHIGGSFSEETEKKFEHFSGLLNNQ    701 - 770
LSPQ                                                                      771 - 774
//

Text Mined References (66)

PMID Year Title
26676674 2016 Tumor-suppressive microRNA-29 family inhibits cancer cell migration and invasion directly targeting LOXL2 in lung squamous cell carcinoma.
26329904 2015 The function and mechanisms of action of LOXL2 in cancer (Review).
26206869 2015 LOXL2 Is Highly Expressed in Cancer-Associated Fibroblasts and Associates to Poor Colon Cancer Survival.
26096783 2015 Tumour-suppressive microRNA-29s directly regulate LOXL2 expression and inhibit cancer cell migration and invasion in renal cell carcinoma.
25959397 2015 LOXL2 Oxidizes Methylated TAF10 and Controls TFIID-Dependent Genes during Neural Progenitor Differentiation.
25759215 2015 Lysyl oxidase-like 2 represses Notch1 expression in the skin to promote squamous cell carcinoma progression.
25275797 2014 Identification of a novel lysyl oxidase-like 2 alternative splicing isoform, LOXL2 ?e13, in esophageal squamous cell carcinoma.
25254241 2014 Exploration of potential roles of a new LOXL2 splicing variant using network knowledge in esophageal squamous cell carcinoma.
25146937 2014 Human lysyl oxidase-like 2.
25128648 2014 Lysyl oxidase-like 2 (LOXL2) from stromal fibroblasts stimulates the progression of gastric cancer.
More...