Property Summary

NCBI Gene PubMed Count 49
Grant Count 32
R01 Count 14
Funding $6,681,527.43
PubMed Score 173.62
PubTator Score 20.40

Knowledge Summary

Patent

No data available

Expression

Gene RIF (16)

PMID Text
25959029 we show for the first time localization of alpha-DB2 in nucleoli and Cajal bodies and provide evidence that a-DB2 is involved in the structure of nucleoli and might modulate nucleolar functions
25305078 our findings suggest that novel mutations in FAM136A and DTNA genes are probably causal variants in FMD.
24014171 Ordered disorder of the astrocytic dystrophin-associated protein complex in the norm and pathology.
22507200 apoptosis-induction in HL-60 cells involves not only classical markers of apoptosis but also a network alpha-DB-associated proteins at the cell membrane, the cytoplasm and nucleus, affecting key cellular transport processes and cellular structure.
21115837 Data show that alpha-dystrobrevin-1 recruits alpha-catulin, which supersensitizes alpha(1D)-AR functional responses by recruiting effector molecules to the signalosome.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20111909 Results suggest that alpha-dystrobrevin isoforms play a central role in cytoskeleton reorganization via their multiple interactions with actin and actin-associating proteins.
19961569 Fundamental functional differences between the alpha-dystrobrevins of mice and humans raises questions about the use of the mouse as a model animal for Duchenne muscular dystrophy.
19460752 Knockdown of dystrobrevin, alpha (DTNA) by shRNA library screening inhibits HIV-1 replication in cultured Jurkat T-cells
18299519 Dystrobrevin mRNA including exons 11A and 12 was increased in both skeletal and cardiac muscle of DM1 patients. The aberrantly spliced alpha-dystrobrevin isoform was localized to the sarcolemma.
More...

AA Sequence

MIEDSGKRGNTMAERRQLFAEMRAQDLDRIRLSTYRTACKLRFVQKKCNLHLVDIWNVIEALRENALNNL      1 - 70
DPNTELNVSRLEAVLSTIFYQLNKRMPTTHQIHVEQSISLLLNFLLAAFDPEGHGKISVFAVKMALATLC     71 - 140
GGKIMDKLRYIFSMISDSSGVMVYGRYDQFLREVLKLPTAVFEGPSFGYTEQSARSCFSQQKKVTLNGFL    141 - 210
DTLMSDPPPQCLVWLPLLHRLANVENVFHPVECSYCHSESMMGFRYRCQQCHNYQLCQDCFWRGHAGGSH    211 - 280
SNQHQMKEYTSWKSPAKKLTNALSKSLSCASSREPLHPMFPDQPEKPLNLAHIVDTWPPRPVTSMNDTLF    281 - 350
SHSVPSSGSPFITRSSPPKDSEVEQNKLLARAAPAFLKGKGIQYSLNVADRLADEHVLIGLYVNMLRNNP    351 - 420
SCMLESSNRLDEEHRLIARYAARLAAESSSSQPPQQRSAPDISFTIDANKQQRQLIAELENKNREILQEI    421 - 490
QRLRLEHEQASQPTPEKAQQNPTLLAELRLLRQRKDELEQRMSALQESRRELMVQLEGLMKLLKTQGAGS    491 - 560
PRSSPSHTISRPIPMPIRSASACSTPTHTPQDSLTGVGGDVQEAFAQSSRRNLRNDLLVAADSITNTMSS    561 - 630
LVKELNSEVGSETESNVDSEFARTQFEDLVPSPTSEKAFLAQIHARKPGYIHSGATTSTMRGDMVTEDAD    631 - 700
PYVQPEDENYENDSVRQLENELQMEEYLKQKLQDEAYQVSLQG                               701 - 743
//

Text Mined References (52)

PMID Year Title
25959029 2015 Localization of ?-Dystrobrevin in Cajal Bodies and Nucleoli: A New Role for ?-Dystrobrevin in the Structure/Stability of the Nucleolus.
25305078 2015 Identification of two novel mutations in FAM136A and DTNA genes in autosomal-dominant familial Meniere's disease.
24014171 2013 Ordered disorder of the astrocytic dystrophin-associated protein complex in the norm and pathology.
22507200 2012 Alpha-Dystrobrevin and its associated proteins in human promyelocytic leukemia cells induced to apoptosis.
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21115837 2010 Alpha-dystrobrevin-1 recruits alpha-catulin to the alpha1D-adrenergic receptor/dystrophin-associated protein complex signalosome.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
20111909 2011 ?-Dystrobrevin distribution and association with other proteins in human promyelocytic NB4 cells treated for granulocytic differentiation.
19961569 2009 Profound human/mouse differences in alpha-dystrobrevin isoforms: a novel syntrophin-binding site and promoter missing in mouse and rat.
19931615 2010 MLC1 trafficking and membrane expression in astrocytes: role of caveolin-1 and phosphorylation.
More...