Property Summary

NCBI Gene PubMed Count 49
PubMed Score 181.47
PubTator Score 20.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Left Ventricular Noncompaction 1 1 0.0 0.0
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0

Expression

  Differential Expression (25)

Disease log2 FC p
acute quadriplegic myopathy -1.526 1.1e-06
astrocytic glioma 1.500 3.2e-02
atypical teratoid / rhabdoid tumor -2.700 9.2e-05
Breast cancer -1.600 1.7e-03
dermatomyositis 1.700 3.2e-03
Down syndrome 1.100 8.2e-03
ependymoma 1.200 6.1e-03
glioblastoma -1.600 1.9e-02
group 3 medulloblastoma -1.700 4.0e-02
intraductal papillary-mucinous adenoma (... -1.600 3.4e-06
intraductal papillary-mucinous carcinoma... -1.400 1.3e-05
intraductal papillary-mucinous neoplasm ... -1.400 3.5e-04
juvenile dermatomyositis 1.030 1.1e-08
lung cancer 1.800 2.3e-04
malignant mesothelioma -3.100 6.8e-09
medulloblastoma, large-cell -4.000 5.3e-06
non primary Sjogren syndrome sicca -1.100 1.8e-02
oligodendroglioma 1.700 1.8e-02
osteosarcoma 1.419 4.1e-03
ovarian cancer -1.700 1.4e-06
pancreatic cancer -1.500 3.5e-05
pediatric high grade glioma -1.400 3.3e-02
Pick disease 1.400 2.1e-02
primitive neuroectodermal tumor -1.600 8.9e-03
subependymal giant cell astrocytoma -1.588 3.4e-03

Protein-protein Interaction (1)

Gene RIF (16)

AA Sequence

MIEDSGKRGNTMAERRQLFAEMRAQDLDRIRLSTYRTACKLRFVQKKCNLHLVDIWNVIEALRENALNNL      1 - 70
DPNTELNVSRLEAVLSTIFYQLNKRMPTTHQIHVEQSISLLLNFLLAAFDPEGHGKISVFAVKMALATLC     71 - 140
GGKIMDKLRYIFSMISDSSGVMVYGRYDQFLREVLKLPTAVFEGPSFGYTEQSARSCFSQQKKVTLNGFL    141 - 210
DTLMSDPPPQCLVWLPLLHRLANVENVFHPVECSYCHSESMMGFRYRCQQCHNYQLCQDCFWRGHAGGSH    211 - 280
SNQHQMKEYTSWKSPAKKLTNALSKSLSCASSREPLHPMFPDQPEKPLNLAHIVDTWPPRPVTSMNDTLF    281 - 350
SHSVPSSGSPFITRSSPPKDSEVEQNKLLARAAPAFLKGKGIQYSLNVADRLADEHVLIGLYVNMLRNNP    351 - 420
SCMLESSNRLDEEHRLIARYAARLAAESSSSQPPQQRSAPDISFTIDANKQQRQLIAELENKNREILQEI    421 - 490
QRLRLEHEQASQPTPEKAQQNPTLLAELRLLRQRKDELEQRMSALQESRRELMVQLEGLMKLLKTQGAGS    491 - 560
PRSSPSHTISRPIPMPIRSASACSTPTHTPQDSLTGVGGDVQEAFAQSSRRNLRNDLLVAADSITNTMSS    561 - 630
LVKELNSEVGSETESNVDSEFARTQFEDLVPSPTSEKAFLAQIHARKPGYIHSGATTSTMRGDMVTEDAD    631 - 700
PYVQPEDENYENDSVRQLENELQMEEYLKQKLQDEAYQVSLQG                               701 - 743
//

Text Mined References (52)

PMID Year Title