Property Summary

NCBI Gene PubMed Count 6
PubMed Score 17.56
PubTator Score 6.95

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
ovarian cancer 8519 3.9e-08
osteosarcoma 7950 5.4e-06
breast carcinoma 1637 1.3e-04
fibroadenoma 559 1.7e-03
invasive ductal carcinoma 2950 4.6e-03
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count Z-score Confidence
esophageal cancer 22 3.176 1.6

Expression

  Differential Expression (5)

Disease log2 FC p
breast carcinoma 1.800 1.3e-04
fibroadenoma 1.500 1.7e-03
invasive ductal carcinoma 1.800 4.6e-03
osteosarcoma -1.887 5.4e-06
ovarian cancer 1.200 3.9e-08

Gene RIF (1)

AA Sequence

MEEGPLPGGLPSPEDAMVTELLSPEGPFASENIGLKAPVKYEEDEFHVFKEAYLGPADPKEPVLHAFNPA      1 - 70
LGADCKGQVKAKLAGGDSDGGELLGEYPGIPELSALEDVALLQAPQPPACNVHFLSSLLPAHRSPAVLPL     71 - 140
GAWVLEGASHPGVRMIPVEIKEAGGTTTSNNPEEATLQNLLAQESCCKFPSSQELEDASCCSLKKDSNPM    141 - 210
VICQLKGGTQMLCIDNSRTRELKALHLVPQYQDQNNYLQSDVPKPMTALVGRFLPASTKLNLITQQLEGA    211 - 280
LPSVVNGSAFPSGSTLPGPPKITLAGYCDCFASGDFCNNCNCNNCCNNLHHDIERFKAIKACLGRNPEAF    281 - 350
QPKIGKGQLGNVKPQHNKGCNCRRSGCLKNYCECYEAQIMCSSICKCIGCKNYEESPERKTLMSMPNYMQ    351 - 420
TGGLEGSHYLPPTKFSGLPRFSHDRRPSSCISWEVVEATCACLLAQGEEAEKEHCSKCLAEQMILEEFGR    421 - 490
CLSQILHTEFKSKGLKME                                                        491 - 508
//

Text Mined References (9)

PMID Year Title