Property Summary

NCBI Gene PubMed Count 6
PubMed Score 16.26
PubTator Score 6.95

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (5)

Disease log2 FC p
osteosarcoma -1.887 0.000
breast carcinoma 1.800 0.000
fibroadenoma 1.500 0.002
invasive ductal carcinoma 1.800 0.005
ovarian cancer 1.200 0.000

Gene RIF (1)

PMID Text
23728617 Treatment of human primary astrocytes with HIV-1 Vpr downregulates expression of eleven genes, BNIP3, CYGB, DUOX2, DUSP1, FOXM1, GAPDH, HPRT1, MT3, MTL5, PTGS2, and SCARA3

AA Sequence

MEEGPLPGGLPSPEDAMVTELLSPEGPFASENIGLKAPVKYEEDEFHVFKEAYLGPADPKEPVLHAFNPA      1 - 70
LGADCKGQVKAKLAGGDSDGGELLGEYPGIPELSALEDVALLQAPQPPACNVHFLSSLLPAHRSPAVLPL     71 - 140
GAWVLEGASHPGVRMIPVEIKEAGGTTTSNNPEEATLQNLLAQESCCKFPSSQELEDASCCSLKKDSNPM    141 - 210
VICQLKGGTQMLCIDNSRTRELKALHLVPQYQDQNNYLQSDVPKPMTALVGRFLPASTKLNLITQQLEGA    211 - 280
LPSVVNGSAFPSGSTLPGPPKITLAGYCDCFASGDFCNNCNCNNCCNNLHHDIERFKAIKACLGRNPEAF    281 - 350
QPKIGKGQLGNVKPQHNKGCNCRRSGCLKNYCECYEAQIMCSSICKCIGCKNYEESPERKTLMSMPNYMQ    351 - 420
TGGLEGSHYLPPTKFSGLPRFSHDRRPSSCISWEVVEATCACLLAQGEEAEKEHCSKCLAEQMILEEFGR    421 - 490
CLSQILHTEFKSKGLKME                                                        491 - 508
//

Text Mined References (9)

PMID Year Title
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
16341674 2005 Transcriptome analysis of human gastric cancer.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14648882 2004 Tesmin transcription is regulated differently during male and female meiosis.
12606435 2003 Native tesmin is a 60-kilodalton protein that undergoes dynamic changes in its localization during spermatogenesis in mice.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
11803038 2002 Germ cell-specific nucleocytoplasmic shuttling protein, tesmin, responsive to heavy metal stress in mouse testes.
10191092 1999 A novel testis-specific metallothionein-like protein, tesmin, is an early marker of male germ cell differentiation.