Property Summary

NCBI Gene PubMed Count 73
PubMed Score 54.93
PubTator Score 317.47

Knowledge Summary


No data available


  Disease (7)

Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Kidney cancer 2613 0.0 0.7
Disease Target Count Z-score Confidence
Griscelli syndrome 24 6.537 3.3


  Differential Expression (24)

Disease log2 FC p
acute myeloid leukemia 1.300 3.9e-02
adult high grade glioma -1.800 1.3e-03
astrocytic glioma -1.300 2.0e-03
Astrocytoma, Pilocytic -1.100 4.7e-04
atypical teratoid / rhabdoid tumor -3.300 1.6e-07
Breast cancer 2.800 4.5e-02
diabetes mellitus -1.100 2.3e-02
ependymoma -1.400 1.6e-03
gastric carcinoma 1.200 3.6e-02
glioblastoma -1.600 9.1e-05
group 3 medulloblastoma -1.400 4.0e-03
interstitial cystitis 1.400 4.4e-04
intraductal papillary-mucinous adenoma (... -1.500 1.2e-02
intraductal papillary-mucinous carcinoma... -1.700 3.7e-03
invasive ductal carcinoma 1.016 4.1e-05
malignant mesothelioma -3.800 1.2e-08
medulloblastoma, large-cell -1.400 2.0e-04
oligodendroglioma -1.300 2.5e-15
osteosarcoma 1.062 1.1e-02
ovarian cancer -2.900 3.2e-08
primitive neuroectodermal tumor -1.400 5.0e-04
psoriasis 1.300 4.7e-09
subependymal giant cell astrocytoma 1.409 2.2e-02
ulcerative colitis 1.200 2.8e-03

Protein-protein Interaction (1)

Gene RIF (38)

AA Sequence

AKHIFPVTFPFNPSSLALETIQIPASLGLGFISRV                                      1821 - 1855

Text Mined References (82)

PMID Year Title