Property Summary

NCBI Gene PubMed Count 23
PubMed Score 92.56
PubTator Score 20.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Rheumatoid arthritis -1.200 2.4e-02
cutaneous lupus erythematosus 1.500 7.2e-03
group 3 medulloblastoma -1.200 1.0e-03
interstitial cystitis 1.200 3.9e-03
malignant mesothelioma 2.500 1.2e-08
non-small cell lung cancer -1.124 5.7e-13
osteosarcoma -1.366 5.7e-03
ovarian cancer -1.200 1.8e-06
ulcerative colitis 1.100 1.8e-03

Synonym

Accession Q9Y4H4 A2BFJ3
Symbols G18
NG1
AGS4
G18.2
C6orf9
G18.1a
G18.1b

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (11)

AA Sequence

MEAERPQEEEDGEQGPPQDEEGWPPPNSTTRPWRSAPPSPPPPGTRHTALGPRSASLLSLQTELLLDLVA      1 - 70
EAQSRRLEEQRATFYTPQNPSSLAPAPLRPLEDREQLYSTILSHQCQRMEAQRSEPPLPPGGQELLELLL     71 - 140
RVQGGGRMEEQRSRPPTHTC                                                      141 - 160
//

Text Mined References (27)

PMID Year Title