Property Summary

NCBI Gene PubMed Count 21
Grant Count 7
R01 Count 5
Funding $611,709.05
PubMed Score 89.98
PubTator Score 20.63

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
Rheumatoid Arthritis -1.200 0.024
malignant mesothelioma 2.500 0.000
cutaneous lupus erythematosus 1.500 0.007
osteosarcoma -1.366 0.006
non-small cell lung cancer -1.124 0.000
interstitial cystitis 1.200 0.004
group 3 medulloblastoma -1.200 0.001
ulcerative colitis 1.100 0.002
ovarian cancer -1.200 0.000

Gene RIF (9)

PMID Text
25271165 findings suggest that GPSM3 acts as a direct negative regulator of NLRP3 function.
22843681 Phosphorylation of GPSM3 by a proline-directed serine/threonine kinase and the resultant association of 14-3-3 is the first description of post-translational regulation of GPSM3 subcellular localization
22167191 GPSM3 increases Gbeta stability until formation of the Gbetagamma dimer, including association of the Gbeta-GPSM3 complex with phosducin-like protein PhLP and T-complex protein 1 subunit eta (CCT7), two known chaperones of neosynthesized Gbeta subunits.
20628086 Observational study of gene-disease association, gene-environment interaction, and pharmacogenomic / toxicogenomic. (HuGE Navigator)
20452976 AGS4-Galpha(i) complexes directly couple to a G-protein-coupled receptor and may serve as substrates for agonist-induced G-protein activation.
19913121 Observational study of gene-disease association. (HuGE Navigator)
19851445 Observational study of gene-disease association. (HuGE Navigator)
19659809 Observational study of gene-disease association. (HuGE Navigator)
14656218 Mutational analysis of the role of GoLoco motifs in guanine nucleotide dissociation inhibitor activity of G18 protein.

AA Sequence

MEAERPQEEEDGEQGPPQDEEGWPPPNSTTRPWRSAPPSPPPPGTRHTALGPRSASLLSLQTELLLDLVA      1 - 70
EAQSRRLEEQRATFYTPQNPSSLAPAPLRPLEDREQLYSTILSHQCQRMEAQRSEPPLPPGGQELLELLL     71 - 140
RVQGGGRMEEQRSRPPTHTC                                                      141 - 160
//

Text Mined References (25)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25271165 2014 G Protein signaling modulator-3 inhibits the inflammasome activity of NLRP3.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23535732 2013 Identification of 23 new prostate cancer susceptibility loci using the iCOGS custom genotyping array.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23042114 2012 Genome-wide association study identifies eight new susceptibility loci for atopic dermatitis in the Japanese population.
22843681 2012 Regulation of the subcellular localization of the G-protein subunit regulator GPSM3 through direct association with 14-3-3 protein.
22167191 2012 G-protein signaling modulator-3 regulates heterotrimeric G-protein dynamics through dual association with G? and G?i protein subunits.
20628086 2010 Variation at the NFATC2 locus increases the risk of thiazolidinedione-induced edema in the Diabetes REduction Assessment with ramipril and rosiglitazone Medication (DREAM) study.
More...