Property Summary

NCBI Gene PubMed Count 190
Grant Count 369
R01 Count 237
Funding $19,304,828.16
PubMed Score 398.14
PubTator Score 270.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (18)

Synonym

Accession Q9Y4H2 Q96RR2 Q9BZG0 Q9Y6I5 IRS-2
Symbols IRS-2

Gene

PDB

3FQW   3FQX  

Gene RIF (149)

PMID Text
26991655 IRS-specific gene signatures represent accurate surrogates of IGF activity and could predict response to anti-IGF therapy in breast cancer.
26684807 Amplification of CUL4A, IRS2, and TFDP1 genes showed a significant difference in disease-free survival by both univariate and multivariate survival analyses in intrahepatic cholangiocarcinoma.
26388164 FSH decreases IRS-2 mRNA degradation indicating post-transcriptional stabilization.
26238771 These data demonstrate for the first time that miR146a suppresses lung cancer progression by repressing IRS2 expression
26040030 Changes in the expression levels of IRS1, IRS2, RIPK2, RSPO1, and DNA JC15 genes might contribute to the development of insulin resistance and glucose intolerance in the obese boys.
26018509 These results indicate that miR-106a* affects renal cell carcinoma (RCC) progression by targeting IRS-2 with suppression of the PI3K/Akt signaling pathway in RCC cells
25959789 meta-analysis of genetic association studies: Data suggest that the D allele of the G1057D SNP in IRS2 has a significant effect on reducing risk of type 2 diabetes mellitus; obesity is a modifier of this association. [META-ANALYSIS, REVIEW]
25830382 IRS2 phosphorylation is cell cycle-regulated and that Plk1 phosphorylation of IRS2 prevents premature mitotic exit via AKT inactivation.
25820822 We conclude that AFB1 may upregulate IRS2 and stimulate lung cancer cell migration through Src
25582198 Repression of IRS2 by miR-30a partially mediated the tumor suppressor effect of miR-30a.
More...

AA Sequence

MASPPRHGPPGPASGDGPNLNNNNNNNNHSVRKCGYLRKQKHGHKRFFVLRGPGAGGDEATAGGGSAPQP      1 - 70
PRLEYYESEKKWRSKAGAPKRVIALDCCLNINKRADAKHKYLIALYTKDEYFAVAAENEQEQEGWYRALT     71 - 140
DLVSEGRAAAGDAPPAAAPAASCSASLPGALGGSAGAAGAEDSYGLVAPATAAYREVWQVNLKPKGLGQS    141 - 210
KNLTGVYRLCLSARTIGFVKLNCEQPSVTLQLMNIRRCGHSDSFFFIEVGRSAVTGPGELWMQADDSVVA    211 - 280
QNIHETILEAMKALKELFEFRPRSKSQSSGSSATHPISVPGARRHHHLVNLPPSQTGLVRRSRTDSLAAT    281 - 350
PPAAKCSSCRVRTASEGDGGAAAGAAAAGARPVSVAGSPLSPGPVRAPLSRSHTLSGGCGGRGSKVALLP    351 - 420
AGGALQHSRSMSMPVAHSPPAATSPGSLSSSSGHGSGSYPPPPGPHPPLPHPLHHGPGQRPSSGSASASG    421 - 490
SPSDPGFMSLDEYGSSPGDLRAFCSHRSNTPESIAETPPARDGGGGGEFYGYMTMDRPLSHCGRSYRRVS    491 - 560
GDAAQDLDRGLRKRTYSLTTPARQRPVPQPSSASLDEYTLMRATFSGSAGRLCPSCPASSPKVAYHPYPE    561 - 630
DYGDIEIGSHRSSSSNLGADDGYMPMTPGAALAGSGSGSCRSDDYMPMSPASVSAPKQILQPRAAAAAAA    631 - 700
AVPSAGPAGPAPTSAAGRTFPASGGGYKASSPAESSPEDSGYMRMWCGSKLSMEHADGKLLPNGDYLNVS    701 - 770
PSDAVTTGTPPDFFSAALHPGGEPLRGVPGCCYSSLPRSYKAPYTCGGDSDQYVLMSSPVGRILEEERLE    771 - 840
PQATPGPSQAASAFGAGPTQPPHPVVPSPVRPSGGRPEGFLGQRGRAVRPTRLSLEGLPSLPSMHEYPLP    841 - 910
PEPKSPGEYINIDFGEPGARLSPPAPPLLASAASSSSLLSASSPASSLGSGTPGTSSDSRQRSPLSDYMN    911 - 980
LDFSSPKSPKPGAPSGHPVGSLDGLLSPEASSPYPPLPPRPSASPSSSLQPPPPPPAPGELYRLPPASAV    981 - 1050
ATAQGPGAASSLSSDTGDNGDYTEMAFGVAATPPQPIAAPPKPEAARVASPTSGVKRLSLMEQVSGVEAF   1051 - 1120
LQASQPPDPHRGAKVIRADPQGGRRRHSSETFSSTTTVTPVSPSFAHNPKRHNSASVENVSLRKSSEGGV   1121 - 1190
GVGPGGGDEPPTSPRQLQPAPPLAPQGRPWTPGQPGGLVGCPGSGGSPMRRETSAGFQNGLNYIAIDVRE   1191 - 1260
EPGLPPQPQPPPPPLPQPGDKSSWGRTRSLGGLISAVGVGSTGGGCGGPGPGALPPANTYASIDFLSHHL   1261 - 1330
KEATIVKE                                                                 1331 - 1338
//

Text Mined References (201)

PMID Year Title
26991655 2016 Insulin Receptor Substrate Adaptor Proteins Mediate Prognostic Gene Expression Profiles in Breast Cancer.
26684807 2015 Recurrent Amplification at 13q34 Targets at CUL4A, IRS2, and TFDP1 As an Independent Adverse Prognosticator in Intrahepatic Cholangiocarcinoma.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26388164 2015 FSH stimulates IRS-2 expression in human granulosa cells through cAMP/SP1, an inoperative FSH action in PCOS patients.
26238771 2015 MicroRNA-146a inhibits epithelial mesenchymal transition in non-small cell lung cancer by targeting insulin receptor substrate 2.
26040030 2015 The expression of CCN2, IQSEC, RSPO1, DNAJC15, RIPK2, IL13RA2, IRS1, and IRS2 genes in blood of obese boys with insulin resistance.
26018509 2015 miR-106a* inhibits the proliferation of renal carcinoma cells by targeting IRS-2.
25959789 2015 Association of the G1057D polymorphism in insulin receptor substrate 2 gene with type 2 diabetes mellitus: a meta-analysis.
25830382 2015 Plk1 phosphorylation of IRS2 prevents premature mitotic exit via AKT inactivation.
25820822 2015 Aflatoxin B1 induces Src phosphorylation and stimulates lung cancer cell migration.
More...