Property Summary

NCBI Gene PubMed Count 30
Grant Count 10
Funding $1,394,544.76
PubMed Score 24.98
PubTator Score 14.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
Multiple myeloma 1.548 0.005
malignant mesothelioma -1.300 0.000
astrocytic glioma -1.100 0.032
ependymoma -1.200 0.023
glioblastoma -1.900 0.000
osteosarcoma -2.195 0.000
atypical teratoid / rhabdoid tumor -1.600 0.001
medulloblastoma -1.500 0.000
medulloblastoma, large-cell -2.900 0.000
hereditary spastic paraplegia -1.019 0.021
pancreatic ductal adenocarcinoma liver m... 1.285 0.045
non-small cell lung cancer -1.406 0.000
intraductal papillary-mucinous adenoma (... 1.300 0.005
intraductal papillary-mucinous carcinoma... 1.200 0.010
lung cancer -2.100 0.010
cystic fibrosis -1.600 0.000
adult high grade glioma -1.400 0.003
psoriasis -1.600 0.000
spina bifida -1.126 0.045
Pick disease 1.300 0.027
Breast cancer -2.400 0.000
ovarian cancer -2.300 0.000

Gene RIF (12)

PMID Text
25332235 SCF(FBXW11) bound, polyubiquitylated, and destabilized RAPGEF2, a guanine nucleotide exchange factor that activates the small GTPase RAP1
25189171 Cdk5-mediated phosphorylation of RapGEF2 controls neuronal migration in the developing cerebral cortex.
24858808 local accumulation of PDZGEF at the apical membrane during establishment of epithelial polarity is mediated by electrostatic interactions between positively charged side chains in the PDZ domain and negatively charged phosphatidic acid.
24340059 NEDD4-1 regulates cell migration and invasion through ubiquitination of CNrasGEF in vitro.
24290981 We report that in response to factors that promote cell motility, the Rap guanine exchange factor RAPGEF2 is rapidly phosphorylated by I-kappa-B-kinase-beta and casein kinase-1alpha and consequently degraded by the proteasome.
23885123 JAM-A regulates epithelial permeability via association with ZO-2, afadin, and PDZ-GEF1 to activate Rap2c and control contraction of the apical cytoskeleton.
23800469 Data indicate that expression of Rapgef2 in embryonic kidney 293T cells enables cAMP-Rap1-ERK signaling.
22422452 DNA methylation shows genome-wide association of NFIX, RAPGEF2 and MSRB3 with gestational age at birth.
21840392 PDZ-GEF activates Rap1 under resting conditions to stabilize cell-cell junctions and maintain basal integrity
17724123 Data show that the interaction of PDZ-GEF1 with an internalized neurotrophin receptor transported to late endosomes induces sustained activation of both Rap1 and ERK and neurite outgrowth.
More...

AA Sequence

MKPLAIPANHGVMGQQEKHSLPADFTKLHLTDSLHPQVTHVSSSHSGCSITSDSGSSSLSDIYQATESEA      1 - 70
GDMDLSGLPETAVDSEDDDDEEDIERASDPLMSRDIVRDCLEKDPIDRTDDDIEQLLEFMHQLPAFANMT     71 - 140
MSVRRELCAVMVFAVVERAGTIVLNDGEELDSWSVILNGSVEVTYPDGKAEILCMGNSFGVSPTMDKEYM    141 - 210
KGVMRTKVDDCQFVCIAQQDYCRILNQVEKNMQKVEEEGEIVMVKEHRELDRTGTRKGHIVIKGTSERLT    211 - 280
MHLVEEHSVVDPTFIEDFLLTYRTFLSSPMEVGKKLLEWFNDPSLRDKVTRVVLLWVNNHFNDFEGDPAM    281 - 350
TRFLEEFENNLEREKMGGHLRLLNIACAAKAKRRLMTLTKPSREAPLPFILLGGSEKGFGIFVDSVDSGS    351 - 420
KATEAGLKRGDQILEVNGQNFENIQLSKAMEILRNNTHLSITVKTNLFVFKELLTRLSEEKRNGAPHLPK    421 - 490
IGDIKKASRYSIPDLAVDVEQVIGLEKVNKKSKANTVGGRNKLKKILDKTRISILPQKPYNDIGIGQSQD    491 - 560
DSIVGLRQTKHIPTALPVSGTLSSSNPDLLQSHHRILDFSATPDLPDQVLRVFKADQQSRYIMISKDTTA    561 - 630
KEVVIQAIREFAVTATPDQYSLCEVSVTPEGVIKQRRLPDQLSKLADRIQLSGRYYLKNNMETETLCSDE    631 - 700
DAQELLRESQISLLQLSTVEVATQLSMRNFELFRNIEPTEYIDDLFKLRSKTSCANLKRFEEVINQETFW    701 - 770
VASEILRETNQLKRMKIIKHFIKIALHCRECKNFNSMFAIISGLNLAPVARLRTTWEKLPNKYEKLFQDL    771 - 840
QDLFDPSRNMAKYRNVLNSQNLQPPIIPLFPVIKKDLTFLHEGNDSKVDGLVNFEKLRMIAKEIRHVGRM    841 - 910
ASVNMDPALMFRTRKKKWRSLGSLSQGSTNATVLDVAQTGGHKKRVRRSSFLNAKKLYEDAQMARKVKQY    911 - 980
LSNLELEMDEESLQTLSLQCEPATNTLPKNPGDKKPVKSETSPVAPRAGSQQKAQSLPQPQQQPPPAHKI    981 - 1050
NQGLQVPAVSLYPSRKKVPVKDLPPFGINSPQALKKILSLSEEGSLERHKKQAEDTISNASSQLSSPPTS   1051 - 1120
PQSSPRKGYTLAPSGTVDNFSDSGHSEISSRSSIVSNSSFDSVPVSLHDERRQRHSVSIVETNLGMGRME   1121 - 1190
RRTMIEPDQYSLGSYAPMSEGRGLYATATVISSPSTEELSQDQGDRASLDAADSGRGSWTSCSSGSHDNI   1191 - 1260
QTIQHQRSWETLPFGHTHFDYSGDPAGLWASSSHMDQIMFSDHSTKYNRQNQSRESLEQAQSRASWASST   1261 - 1330
GYWGEDSEGDTGTIKRRGGKDVSIEAESSSLTSVTTEETKPVPMPAHIAVASSTTKGLIARKEGRYREPP   1331 - 1400
PTPPGYIGIPITDFPEGHSHPARKPPDYNVALQRSRMVARSSDTAGPSSVQQPHGHPTSSRPVNKPQWHK   1401 - 1470
PNESDPRLAPYQSQGFSTEEDEDEQVSAV                                            1471 - 1499
//

Text Mined References (38)

PMID Year Title
25332235 2015 Substrate trapping proteomics reveals targets of the ?TrCP2/FBXW11 ubiquitin ligase.
25189171 2014 Cdk5-mediated phosphorylation of RapGEF2 controls neuronal migration in the developing cerebral cortex.
24858808 2014 The PDZ domain of the guanine nucleotide exchange factor PDZGEF directs binding to phosphatidic acid during brush border formation.
24340059 2013 NEDD4-1 regulates migration and invasion of glioma cells through CNrasGEF ubiquitination in vitro.
24290981 2013 Control of epithelial cell migration and invasion by the IKK?- and CK1?-mediated degradation of RAPGEF2.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23885123 2013 JAM-A associates with ZO-2, afadin, and PDZ-GEF1 to activate Rap2c and regulate epithelial barrier function.
23800469 2013 Rapgef2 connects GPCR-mediated cAMP signals to ERK activation in neuronal and endocrine cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22797597 2012 Rap2A links intestinal cell polarity to brush border formation.
More...