Property Summary

NCBI Gene PubMed Count 30
PubMed Score 28.95
PubTator Score 14.55

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (22)

Disease log2 FC p
adult high grade glioma -1.400 3.2e-03
astrocytic glioma -1.100 3.2e-02
atypical teratoid / rhabdoid tumor -1.600 1.3e-03
Breast cancer -1.300 8.8e-13
cystic fibrosis -1.600 3.6e-05
ependymoma -1.200 2.3e-02
glioblastoma -1.100 4.6e-02
group 4 medulloblastoma -1.100 1.5e-02
hereditary spastic paraplegia -1.019 2.1e-02
intraductal papillary-mucinous adenoma (... 1.300 5.1e-03
intraductal papillary-mucinous carcinoma... 1.200 9.9e-03
lung cancer -2.100 9.7e-03
malignant mesothelioma -1.200 8.2e-05
medulloblastoma, large-cell -2.900 2.1e-05
Multiple myeloma 1.548 5.4e-03
non-small cell lung cancer -1.406 4.5e-10
osteosarcoma 1.902 2.6e-05
ovarian cancer -2.300 3.7e-10
pancreatic ductal adenocarcinoma liver m... 1.285 4.5e-02
Pick disease 1.300 2.7e-02
psoriasis -1.600 6.1e-08
spina bifida -1.126 4.5e-02

Gene RIF (12)

AA Sequence

MKPLAIPANHGVMGQQEKHSLPADFTKLHLTDSLHPQVTHVSSSHSGCSITSDSGSSSLSDIYQATESEA      1 - 70
GDMDLSGLPETAVDSEDDDDEEDIERASDPLMSRDIVRDCLEKDPIDRTDDDIEQLLEFMHQLPAFANMT     71 - 140
MSVRRELCAVMVFAVVERAGTIVLNDGEELDSWSVILNGSVEVTYPDGKAEILCMGNSFGVSPTMDKEYM    141 - 210
KGVMRTKVDDCQFVCIAQQDYCRILNQVEKNMQKVEEEGEIVMVKEHRELDRTGTRKGHIVIKGTSERLT    211 - 280
MHLVEEHSVVDPTFIEDFLLTYRTFLSSPMEVGKKLLEWFNDPSLRDKVTRVVLLWVNNHFNDFEGDPAM    281 - 350
TRFLEEFENNLEREKMGGHLRLLNIACAAKAKRRLMTLTKPSREAPLPFILLGGSEKGFGIFVDSVDSGS    351 - 420
KATEAGLKRGDQILEVNGQNFENIQLSKAMEILRNNTHLSITVKTNLFVFKELLTRLSEEKRNGAPHLPK    421 - 490
IGDIKKASRYSIPDLAVDVEQVIGLEKVNKKSKANTVGGRNKLKKILDKTRISILPQKPYNDIGIGQSQD    491 - 560
DSIVGLRQTKHIPTALPVSGTLSSSNPDLLQSHHRILDFSATPDLPDQVLRVFKADQQSRYIMISKDTTA    561 - 630
KEVVIQAIREFAVTATPDQYSLCEVSVTPEGVIKQRRLPDQLSKLADRIQLSGRYYLKNNMETETLCSDE    631 - 700
DAQELLRESQISLLQLSTVEVATQLSMRNFELFRNIEPTEYIDDLFKLRSKTSCANLKRFEEVINQETFW    701 - 770
VASEILRETNQLKRMKIIKHFIKIALHCRECKNFNSMFAIISGLNLAPVARLRTTWEKLPNKYEKLFQDL    771 - 840
QDLFDPSRNMAKYRNVLNSQNLQPPIIPLFPVIKKDLTFLHEGNDSKVDGLVNFEKLRMIAKEIRHVGRM    841 - 910
ASVNMDPALMFRTRKKKWRSLGSLSQGSTNATVLDVAQTGGHKKRVRRSSFLNAKKLYEDAQMARKVKQY    911 - 980
LSNLELEMDEESLQTLSLQCEPATNTLPKNPGDKKPVKSETSPVAPRAGSQQKAQSLPQPQQQPPPAHKI    981 - 1050
NQGLQVPAVSLYPSRKKVPVKDLPPFGINSPQALKKILSLSEEGSLERHKKQAEDTISNASSQLSSPPTS   1051 - 1120
PQSSPRKGYTLAPSGTVDNFSDSGHSEISSRSSIVSNSSFDSVPVSLHDERRQRHSVSIVETNLGMGRME   1121 - 1190
RRTMIEPDQYSLGSYAPMSEGRGLYATATVISSPSTEELSQDQGDRASLDAADSGRGSWTSCSSGSHDNI   1191 - 1260
QTIQHQRSWETLPFGHTHFDYSGDPAGLWASSSHMDQIMFSDHSTKYNRQNQSRESLEQAQSRASWASST   1261 - 1330
GYWGEDSEGDTGTIKRRGGKDVSIEAESSSLTSVTTEETKPVPMPAHIAVASSTTKGLIARKEGRYREPP   1331 - 1400
PTPPGYIGIPITDFPEGHSHPARKPPDYNVALQRSRMVARSSDTAGPSSVQQPHGHPTSSRPVNKPQWHK   1401 - 1470
PNESDPRLAPYQSQGFSTEEDEDEQVSAV                                            1471 - 1499
//

Text Mined References (38)

PMID Year Title