Property Summary

NCBI Gene PubMed Count 30
PubMed Score 24.98
PubTator Score 14.55

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
Breast cancer 3099 1.5566200515268E-40
ovarian cancer 8492 3.70308788253763E-10
non-small cell lung cancer 2798 4.51455597865492E-10
psoriasis 6685 6.07799735643696E-8
osteosarcoma 7933 3.99441055268283E-6
medulloblastoma 1524 5.41094255527164E-6
malignant mesothelioma 3163 1.59383499942976E-5
medulloblastoma, large-cell 6234 2.05208908819896E-5
cystic fibrosis 1670 3.63404020256517E-5
glioblastoma 5572 9.38297281998858E-5
atypical teratoid / rhabdoid tumor 4369 0.00132812261530244
adult high grade glioma 2148 0.0032303487784225
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00509531928641746
Multiple myeloma 1328 0.00537781129378519
lung cancer 4473 0.00968999703357746
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00990552908135109
hereditary spastic paraplegia 313 0.0205140286230812
ependymoma 2514 0.0233262894374849
Pick disease 1893 0.0273177449132299
astrocytic glioma 2241 0.0322109366113344
spina bifida 1064 0.045046261339187
pancreatic ductal adenocarcinoma liver metastasis 1795 0.0453584616822814
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Gastric cardia adenocarcinoma 4 3.016 1.5

Expression

  Differential Expression (22)

Disease log2 FC p
Multiple myeloma 1.548 0.005
malignant mesothelioma -1.300 0.000
astrocytic glioma -1.100 0.032
ependymoma -1.200 0.023
glioblastoma -1.900 0.000
osteosarcoma -2.195 0.000
atypical teratoid / rhabdoid tumor -1.600 0.001
medulloblastoma -1.500 0.000
medulloblastoma, large-cell -2.900 0.000
hereditary spastic paraplegia -1.019 0.021
pancreatic ductal adenocarcinoma liver m... 1.285 0.045
non-small cell lung cancer -1.406 0.000
intraductal papillary-mucinous adenoma (... 1.300 0.005
intraductal papillary-mucinous carcinoma... 1.200 0.010
lung cancer -2.100 0.010
cystic fibrosis -1.600 0.000
adult high grade glioma -1.400 0.003
psoriasis -1.600 0.000
spina bifida -1.126 0.045
Pick disease 1.300 0.027
Breast cancer -2.400 0.000
ovarian cancer -2.300 0.000

Synonym

Accession Q9Y4G8 D3DP27
Symbols RA-GEF
NRAPGEP
PDZGEF1
Rap-GEP
CNrasGEF
PDZ-GEF1
RA-GEF-1
nRap GEP

Gene

  Ortholog (14)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG Inparanoid
Horse OMA Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG
Opossum OMA Inparanoid
Platypus OMA Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG
C. elegans OMA EggNOG Inparanoid

Gene RIF (12)

PMID Text
25332235 SCF(FBXW11) bound, polyubiquitylated, and destabilized RAPGEF2, a guanine nucleotide exchange factor that activates the small GTPase RAP1
25189171 Cdk5-mediated phosphorylation of RapGEF2 controls neuronal migration in the developing cerebral cortex.
24858808 local accumulation of PDZGEF at the apical membrane during establishment of epithelial polarity is mediated by electrostatic interactions between positively charged side chains in the PDZ domain and negatively charged phosphatidic acid.
24340059 NEDD4-1 regulates cell migration and invasion through ubiquitination of CNrasGEF in vitro.
24290981 We report that in response to factors that promote cell motility, the Rap guanine exchange factor RAPGEF2 is rapidly phosphorylated by I-kappa-B-kinase-beta and casein kinase-1alpha and consequently degraded by the proteasome.
23885123 JAM-A regulates epithelial permeability via association with ZO-2, afadin, and PDZ-GEF1 to activate Rap2c and control contraction of the apical cytoskeleton.
23800469 Data indicate that expression of Rapgef2 in embryonic kidney 293T cells enables cAMP-Rap1-ERK signaling.
22422452 DNA methylation shows genome-wide association of NFIX, RAPGEF2 and MSRB3 with gestational age at birth.
21840392 PDZ-GEF activates Rap1 under resting conditions to stabilize cell-cell junctions and maintain basal integrity
17724123 Data show that the interaction of PDZ-GEF1 with an internalized neurotrophin receptor transported to late endosomes induces sustained activation of both Rap1 and ERK and neurite outgrowth.
More...

AA Sequence

MKPLAIPANHGVMGQQEKHSLPADFTKLHLTDSLHPQVTHVSSSHSGCSITSDSGSSSLSDIYQATESEA      1 - 70
GDMDLSGLPETAVDSEDDDDEEDIERASDPLMSRDIVRDCLEKDPIDRTDDDIEQLLEFMHQLPAFANMT     71 - 140
MSVRRELCAVMVFAVVERAGTIVLNDGEELDSWSVILNGSVEVTYPDGKAEILCMGNSFGVSPTMDKEYM    141 - 210
KGVMRTKVDDCQFVCIAQQDYCRILNQVEKNMQKVEEEGEIVMVKEHRELDRTGTRKGHIVIKGTSERLT    211 - 280
MHLVEEHSVVDPTFIEDFLLTYRTFLSSPMEVGKKLLEWFNDPSLRDKVTRVVLLWVNNHFNDFEGDPAM    281 - 350
TRFLEEFENNLEREKMGGHLRLLNIACAAKAKRRLMTLTKPSREAPLPFILLGGSEKGFGIFVDSVDSGS    351 - 420
KATEAGLKRGDQILEVNGQNFENIQLSKAMEILRNNTHLSITVKTNLFVFKELLTRLSEEKRNGAPHLPK    421 - 490
IGDIKKASRYSIPDLAVDVEQVIGLEKVNKKSKANTVGGRNKLKKILDKTRISILPQKPYNDIGIGQSQD    491 - 560
DSIVGLRQTKHIPTALPVSGTLSSSNPDLLQSHHRILDFSATPDLPDQVLRVFKADQQSRYIMISKDTTA    561 - 630
KEVVIQAIREFAVTATPDQYSLCEVSVTPEGVIKQRRLPDQLSKLADRIQLSGRYYLKNNMETETLCSDE    631 - 700
DAQELLRESQISLLQLSTVEVATQLSMRNFELFRNIEPTEYIDDLFKLRSKTSCANLKRFEEVINQETFW    701 - 770
VASEILRETNQLKRMKIIKHFIKIALHCRECKNFNSMFAIISGLNLAPVARLRTTWEKLPNKYEKLFQDL    771 - 840
QDLFDPSRNMAKYRNVLNSQNLQPPIIPLFPVIKKDLTFLHEGNDSKVDGLVNFEKLRMIAKEIRHVGRM    841 - 910
ASVNMDPALMFRTRKKKWRSLGSLSQGSTNATVLDVAQTGGHKKRVRRSSFLNAKKLYEDAQMARKVKQY    911 - 980
LSNLELEMDEESLQTLSLQCEPATNTLPKNPGDKKPVKSETSPVAPRAGSQQKAQSLPQPQQQPPPAHKI    981 - 1050
NQGLQVPAVSLYPSRKKVPVKDLPPFGINSPQALKKILSLSEEGSLERHKKQAEDTISNASSQLSSPPTS   1051 - 1120
PQSSPRKGYTLAPSGTVDNFSDSGHSEISSRSSIVSNSSFDSVPVSLHDERRQRHSVSIVETNLGMGRME   1121 - 1190
RRTMIEPDQYSLGSYAPMSEGRGLYATATVISSPSTEELSQDQGDRASLDAADSGRGSWTSCSSGSHDNI   1191 - 1260
QTIQHQRSWETLPFGHTHFDYSGDPAGLWASSSHMDQIMFSDHSTKYNRQNQSRESLEQAQSRASWASST   1261 - 1330
GYWGEDSEGDTGTIKRRGGKDVSIEAESSSLTSVTTEETKPVPMPAHIAVASSTTKGLIARKEGRYREPP   1331 - 1400
PTPPGYIGIPITDFPEGHSHPARKPPDYNVALQRSRMVARSSDTAGPSSVQQPHGHPTSSRPVNKPQWHK   1401 - 1470
PNESDPRLAPYQSQGFSTEEDEDEQVSAV                                            1471 - 1499
//

Text Mined References (38)

PMID Year Title
25332235 2015 Substrate trapping proteomics reveals targets of the ?TrCP2/FBXW11 ubiquitin ligase.
25189171 2014 Cdk5-mediated phosphorylation of RapGEF2 controls neuronal migration in the developing cerebral cortex.
24858808 2014 The PDZ domain of the guanine nucleotide exchange factor PDZGEF directs binding to phosphatidic acid during brush border formation.
24340059 2013 NEDD4-1 regulates migration and invasion of glioma cells through CNrasGEF ubiquitination in vitro.
24290981 2013 Control of epithelial cell migration and invasion by the IKK?- and CK1?-mediated degradation of RAPGEF2.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23885123 2013 JAM-A associates with ZO-2, afadin, and PDZ-GEF1 to activate Rap2c and regulate epithelial barrier function.
23800469 2013 Rapgef2 connects GPCR-mediated cAMP signals to ERK activation in neuronal and endocrine cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22797597 2012 Rap2A links intestinal cell polarity to brush border formation.
More...