Property Summary

NCBI Gene PubMed Count 17
PubMed Score 5.45
PubTator Score 3.58

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count P-value
ovarian cancer 8492 9.77832056770689E-11
atypical teratoid / rhabdoid tumor 4369 2.67270369880841E-7
glioblastoma 5572 3.75869785813369E-6
medulloblastoma, large-cell 6234 8.19895819656979E-5
osteosarcoma 7933 0.00204962753317181
oligodendroglioma 2849 0.00228502595834244
ependymoma 2514 0.00428682776958107
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00681727789726733
astrocytic glioma 2241 0.00692514016801595
psoriasis 6685 0.0115006758713174
adult high grade glioma 2148 0.0124769615017538
group 4 medulloblastoma 1875 0.0233242074692076
subependymal giant cell astrocytoma 2287 0.023695941813548
intraductal papillary-mucinous neoplasm (IPMN) 3289 0.033598487962762
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Infertility 163 3.326 1.7

Expression

  Differential Expression (14)

Synonym

Accession Q9Y4F3 A8MSK2 B2RNX2 B4DYY9 B7ZMG1 B7ZMG2 F8VV09 Q6P1R6 Q8WYR2 Q9Y4J9
Symbols LKAP
MARF1
PPP1R34

Gene

PDB

2DGX   2DIU  

Pathway (1)

Gene RIF (1)

PMID Text
24755989 LMKB is the first protein identified to date that interacts with this portion of Ge-1. LMKB was expressed in human B and T lymphocyte cell lines; depletion of LMKB increased expression of IFI44L.

AA Sequence

MMEGNGTENSCSRTRGWLQQDNDAKPWLWKFSNCFSRPEQTLPHSPQTKEYMENKKVAVELKDVPSPLHA      1 - 70
GSKLFPAVPLPDIRSLQQPKIQLSSVPKVSCCAHCPNEPSTSPMRFGGGGGGSGGTSSLIHPGALLDSQS     71 - 140
TRTITCQVGSGFAFQSASSLQNASARNNLAGIASDFPSMCLESNLSSCKHLPCCGKLHFQSCHGNVHKLH    141 - 210
QFPSLQGCTSAGYFPCSDFTSGAPGHLEEHISQSELTPHLCTNSLHLNVVPPVCLKGSLYCEDCLNKPAR    211 - 280
NSIIDAAKVWPNIPPPNTQPAPLAVPLCNGCGTKGTGKETTLLLATSLGKAASKFGSPEVAVAGQVLENL    281 - 350
PPIGVFWDIENCSVPSGRSATAVVQRIREKFFKGHREAEFICVCDISKENKEVIQELNNCQVTVAHINAT    351 - 420
AKNAADDKLRQSLRRFANTHTAPATVVLVSTDVNFALELSDLRHRHGFHIILVHKNQASEALLHHANELI    421 - 490
RFEEFISDLPPRLPLKMPQCHTLLYVYNLPANKDGKSVSNRLRRLSDNCGGKVLSITGCSAILRFINQDS    491 - 560
AERAQKRMENEDVFGNRIIVSFTPKNRELCETKSSNAIADKVKSPKKLKNPKLCLIKDASEQSSSAKATP    561 - 630
GKGSQANSGSATKNTNVKSLQELCRMESKTGHRNSEHQQGHLRLVVPTHGNSSAAVSTPKNSGVAEPVYK    631 - 700
TSQKKENLSARSVTSSPVEKKDKEETVFQVSYPSAFSKLVASRQVSPLLASQSWSSRSMSPNLLNRASPL    701 - 770
AFNIANSSSEADCPDPFANGADVQVSNIDYRLSRKELQQLLQEAFARHGKVKSVELSPHTDYQLKAVVQM    771 - 840
ENLQDAIGAVNSLHRYKIGSKKILVSLATGAASKSLSLLSAETMSVLQDAPACCLPLFKFTDIYEKKFGH    841 - 910
KLNVSDLYKLTDTVAIREQGNGRLVCLLPSSQARQSPLGSSQSHDGSSTNCSPIIFEELEYHEPVCRQHC    911 - 980
SNKDFSEHEFDPDSYKIPFVILSLKTFAPQVHSLLQTHEGTVPLLSFPDCYIAEFGDLEVVQENQGGVPL    981 - 1050
EHFITCVPGVNIATAQNGIKVVKWIHNKPPPPNTDPWLLRSKSPVGNPQLIQFSREVIDLLKSQPSCVIP   1051 - 1120
ISHFIPSYHHHFAKQCRVSDYGYSKLIELLEAVPHVLQILGMGSKRLLTLTHRAQVKRFTQDLLKLLKSQ   1121 - 1190
ASKQVIVREFSQAYHWCFSKDWDVTEYGVCELIDIVSEIPDTTICLSQQDNEMVICIPKRERTQDEIERT   1191 - 1260
KQFSKDVVDLLRHQPHFRMPFNKFIPSYHHHFGRQCKLAYYGFTKLLELFEAIPDTLQVLECGEEKILTL   1261 - 1330
TEVERFKALAAQFVKLLRSQKDNCLMMTDLLTEYAKTFGYTFRLQDYDVSSISALTQKLCHVVKVADIES   1331 - 1400
GRQIQLINRKSLRSLTAQLLVLLMSWEGTTHLSVEELKRHYESTHNTPLNPCEYGFMTLTELLKSLPYLV   1401 - 1470
EVFTNDKMEECVKLTSLYLFAKNVRSLLHTYHYQQIFLHEFSMAYTKYVGETLQPKTYGHSSVEELLGAI   1471 - 1540
PQVVWIKGHGHKRIVVLKNDMKSRLSSLSLSPANHENQPSEGERILEVPESHTASELKLGADGSGPSHTE   1541 - 1610
QELLRLTDDSPVDLLCAPVPSCLPSPQLRPDPVILQSADLIQFEERPQEPSEIMILNQEEKMEIPIPGKS   1611 - 1680
KTLTSDSSSSCISAAVPVPPCPSSETSESLLSKDPVESPAKKQPKNRVKLAANFSLAPITKL           1681 - 1742
//

Text Mined References (22)

PMID Year Title
24823311 2014 Genome-wide association study of plasma N6 polyunsaturated fatty acids within the cohorts for heart and aging research in genomic epidemiology consortium.
24755989 2014 LMKB/MARF1 localizes to mRNA processing bodies, interacts with Ge-1, and regulates IFI44L gene expression.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23090997 2012 Meiosis arrest female 1 (MARF1) has nuage-like function in mammalian oocytes.
22442484 2012 MARF1 regulates essential oogenic processes in mice.
20305267 2010 LOTUS, a new domain associated with small RNA pathways in the germline.
20302647 2010 OST-HTH: a novel predicted RNA-binding domain.
19946888 2010 Defining the membrane proteome of NK cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
19389623 2009 Docking motif-guided mapping of the interactome of protein phosphatase-1.
More...