Property Summary

NCBI Gene PubMed Count 23
PubMed Score 36.22
PubTator Score 7.39

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (4)

Disease Target Count
Substance-Related Disorders 114
Disease Target Count P-value
oligodendroglioma 2849 1.65456291272634E-9
pilocytic astrocytoma 3086 2.27497072166615E-8
ovarian cancer 8492 9.99326568908149E-6
ependymoma 2514 3.9329613987263E-5
adult high grade glioma 2148 2.98450126260234E-4
osteosarcoma 7933 2.99417370031451E-4
interstitial cystitis 2299 3.70514553180304E-4
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.00157531652200032
psoriasis 6685 0.00183496860652126
intraductal papillary-mucinous adenoma (IPMA) 2956 0.00234932483123486
medulloblastoma, large-cell 6234 0.00369444035280413
invasive ductal carcinoma 2950 0.00830309094406682
glioblastoma 5572 0.0095728460556848
pancreatic cancer 2300 0.0157526867308015
esophageal adenocarcinoma 737 0.0190553920760902
primitive neuroectodermal tumor 3031 0.0368013525826755
atypical teratoid / rhabdoid tumor 4369 0.0435194642797168
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0
Disease Target Count Z-score Confidence
Alzheimer's disease 644 0.0 1.0
Liver disease 219 0.0 1.0

Expression

  Differential Expression (17)

Synonym

Accession Q9Y4F1 Q5JVI9 Q6IQ29
Symbols CDEP
PLEKHC2
PPP1R75
FARP1-IT1

Gene

PDB

4H6Y  

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA Inparanoid
Anole lizard OMA EggNOG Inparanoid
Xenopus OMA EggNOG
Zebrafish OMA EggNOG Inparanoid

Gene RIF (2)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19475631 Meta-analysis of gene-disease association. (HuGE Navigator)

AA Sequence

MGEIEQRPTPGSRLGAPENSGISTLERGQKPPPTPSGKLVSIKIQMLDDTQEAFEVPQRAPGKVLLDAVC      1 - 70
NHLNLVEGDYFGLEFPDHKKITVWLDLLKPIVKQIRRPKHVVVKFVVKFFPPDHTQLQEELTRYLFALQV     71 - 140
KQDLAQGRLTCNDTSAALLISHIVQSEIGDFDEALDREHLAKNKYIPQQDALEDKIVEFHHNHIGQTPAE    141 - 210
SDFQLLEIARRLEMYGIRLHPAKDREGTKINLAVANTGILVFQGFTKINAFNWAKVRKLSFKRKRFLIKL    211 - 280
RPDANSAYQDTLEFLMASRDFCKSFWKICVEHHAFFRLFEEPKPKPKPVLFSRGSSFRFSGRTQKQVLDY    281 - 350
VKEGGHKKVQFERKHSKIHSIRSLASQPTELNSEVLEQSQQSTSLTFGEGAESPGGQSCRRGKEPKVSAG    351 - 420
EPGSHPSPAPRRSPAGNKQADGAASAPTEEEEEVVKDRTQQSKPQPPQPSTGSLTGSPHLSELSVNSQGG    421 - 490
VAPANVTLSPNLSPDTKQASPLISPLLNDQACPRTDDEDEGRRKRFPTDKAYFIAKEVSTTERTYLKDLE    491 - 560
VITSWFQSTVSKEDAMPEALKSLIFPNFEPLHKFHTNFLKEIEQRLALWEGRSNAQIRDYQRIGDVMLKN    561 - 630
IQGMKHLAAHLWKHSEALEALENGIKSSRRLENFCRDFELQKVCYLPLNTFLLRPLHRLMHYKQVLERLC    631 - 700
KHHPPSHADFRDCRAALAEITEMVAQLHGTMIKMENFQKLHELKKDLIGIDNLVVPGREFIRLGSLSKLS    701 - 770
GKGLQQRMFFLFNDVLLYTSRGLTASNQFKVHGQLPLYGMTIEESEDEWGVPHCLTLRGQRQSIIVAASS    771 - 840
RSEMEKWVEDIQMAIDLAEKSSSPAPEFLASSPPDNKSPDEATAADQESEDDLSASRTSLERQAPHRGNT    841 - 910
MVHVCWHRNTSVSMVDFSIAVENQLSGNLLRKFKNSNGWQKLWVVFTNFCLFFYKSHQDNHPLASLPLLG    911 - 980
YSLTIPSESENIQKDYVFKLHFKSHVYYFRAESEYTFERWMEVIRSATSSASRPHVLSHKESLVY         981 - 1045
//

Text Mined References (35)

PMID Year Title
25201988 2014 Common genetic variants associated with cognitive performance identified using the proxy-phenotype method.
25187353 2014 Clozapine-induced agranulocytosis is associated with rare HLA-DQB1 and HLA-B alleles.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23793025 2013 Genome-wide meta-analysis identifies new susceptibility loci for migraine.
23375260 2013 Structural basis for autoinhibition of the guanine nucleotide exchange factor FARP2.
23251661 2012 Novel genetic loci identified for the pathophysiology of childhood obesity in the Hispanic population.
23209303 2012 The novel synaptogenic protein Farp1 links postsynaptic cytoskeletal dynamics and transsynaptic organization.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22952603 2012 Genome-wide association study of d-amphetamine response in healthy volunteers identifies putative associations, including cadherin 13 (CDH13).
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
More...