Property Summary

NCBI Gene PubMed Count 24
PubMed Score 38.27
PubTator Score 7.39

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
adult high grade glioma -1.800 3.0e-04
Astrocytoma, Pilocytic -2.300 2.0e-08
atypical teratoid / rhabdoid tumor -1.100 4.4e-02
ependymoma -1.200 3.9e-05
esophageal adenocarcinoma 1.300 1.9e-02
glioblastoma -1.600 1.8e-05
interstitial cystitis -1.100 4.1e-03
intraductal papillary-mucinous adenoma (... 1.800 2.3e-03
intraductal papillary-mucinous carcinoma... -1.200 1.6e-03
invasive ductal carcinoma 1.400 8.3e-03
medulloblastoma, large-cell -1.100 8.6e-03
oligodendroglioma -1.100 1.7e-09
osteosarcoma 1.055 2.8e-02
ovarian cancer 1.100 4.7e-04
pancreatic cancer -1.100 1.6e-02
primitive neuroectodermal tumor -1.100 3.7e-02
psoriasis -1.300 1.8e-03

Gene RIF (3)

AA Sequence

MGEIEQRPTPGSRLGAPENSGISTLERGQKPPPTPSGKLVSIKIQMLDDTQEAFEVPQRAPGKVLLDAVC      1 - 70
NHLNLVEGDYFGLEFPDHKKITVWLDLLKPIVKQIRRPKHVVVKFVVKFFPPDHTQLQEELTRYLFALQV     71 - 140
KQDLAQGRLTCNDTSAALLISHIVQSEIGDFDEALDREHLAKNKYIPQQDALEDKIVEFHHNHIGQTPAE    141 - 210
SDFQLLEIARRLEMYGIRLHPAKDREGTKINLAVANTGILVFQGFTKINAFNWAKVRKLSFKRKRFLIKL    211 - 280
RPDANSAYQDTLEFLMASRDFCKSFWKICVEHHAFFRLFEEPKPKPKPVLFSRGSSFRFSGRTQKQVLDY    281 - 350
VKEGGHKKVQFERKHSKIHSIRSLASQPTELNSEVLEQSQQSTSLTFGEGAESPGGQSCRRGKEPKVSAG    351 - 420
EPGSHPSPAPRRSPAGNKQADGAASAPTEEEEEVVKDRTQQSKPQPPQPSTGSLTGSPHLSELSVNSQGG    421 - 490
VAPANVTLSPNLSPDTKQASPLISPLLNDQACPRTDDEDEGRRKRFPTDKAYFIAKEVSTTERTYLKDLE    491 - 560
VITSWFQSTVSKEDAMPEALKSLIFPNFEPLHKFHTNFLKEIEQRLALWEGRSNAQIRDYQRIGDVMLKN    561 - 630
IQGMKHLAAHLWKHSEALEALENGIKSSRRLENFCRDFELQKVCYLPLNTFLLRPLHRLMHYKQVLERLC    631 - 700
KHHPPSHADFRDCRAALAEITEMVAQLHGTMIKMENFQKLHELKKDLIGIDNLVVPGREFIRLGSLSKLS    701 - 770
GKGLQQRMFFLFNDVLLYTSRGLTASNQFKVHGQLPLYGMTIEESEDEWGVPHCLTLRGQRQSIIVAASS    771 - 840
RSEMEKWVEDIQMAIDLAEKSSSPAPEFLASSPPDNKSPDEATAADQESEDDLSASRTSLERQAPHRGNT    841 - 910
MVHVCWHRNTSVSMVDFSIAVENQLSGNLLRKFKNSNGWQKLWVVFTNFCLFFYKSHQDNHPLASLPLLG    911 - 980
YSLTIPSESENIQKDYVFKLHFKSHVYYFRAESEYTFERWMEVIRSATSSASRPHVLSHKESLVY         981 - 1045
//

Text Mined References (36)

PMID Year Title