Property Summary

NCBI Gene PubMed Count 34
Grant Count 1
Funding $66,666.67
PubMed Score 36.80
PubTator Score 23.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
Waldenstrons macroglobulinemia -1.267 0.011
urothelial carcinoma -1.100 0.003
malignant mesothelioma -1.500 0.000
osteosarcoma -3.464 0.000
posterior fossa group B ependymoma 2.100 0.000
glioblastoma 2.100 0.000
atypical teratoid / rhabdoid tumor -2.000 0.000
medulloblastoma 1.200 0.001
medulloblastoma, large-cell -1.800 0.000
primitive neuroectodermal tumor 1.300 0.003
hereditary spastic paraplegia -1.071 0.004
Atopic dermatitis -1.300 0.000
lung cancer -1.300 0.000
adult high grade glioma 1.800 0.000
pilocytic astrocytoma 1.500 0.000
ovarian cancer -1.100 0.000

Synonym

Accession Q9Y4E8 Q08AL5 Q9H8G9 Q9HCA6 Q9UNP0 Q9Y5B5
Symbols UNPH4
UNPH-2

Gene

 Grant Application (1)

PDB

1W6V   3LMN   3PPA   3PV1   3T9L   4A3O   4A3P   5JJW  

Gene RIF (21)

PMID Text
26435193 SMURF2 is a critical target of USP15 in the TGF-beta signaling pathway.
26061460 our data demonstrate that USP15 acts as a negative regulator of RIG-I signaling via DUB-dependent and independent mechanisms.
24939309 Data suggest that ubiquitin specific peptidase 15 (USP15) may play a role in the pathogenesis of psoriasis through regulating the type I TGFbeta receptor (TbetaR-I)/Smad7 pathway.
24852371 These data identify USP15 as an antagonist of Parkin and suggest that USP15 inhibition could be a therapeutic strategy for PD cases caused by reduced Parkin levels.
24850914 Data show that USP15 enhances BMP-induced phosphorylation of SMAD1 by interacting with and deubiquitylating ALK3.
24777531 USP15 deficiency promoted T cell activation in vitro and enhanced T cell responses to bacterial infection and tumor challenge in vivo.
24526689 SART3 recruits ubH2B, which may be evicted from DNA during transcription, for deubiquitination by Usp15
24399297 Data indicate ubiquitin-specific protease 15 (USP15) as a critical regulator of the tripartite motif protein 25 (TRIM25)- and RNA sensor retinoic acid-inducible gene-I (RIG-I)-mediated antiviral immune response.
23727018 USP15 specifically deubiquitinates Keap1, which suppresses the Nrf2 pathway.
23708518 The deubiquitylase USP15 stabilizes newly synthesized REST and rescues its expression at mitotic exit.
More...

AA Sequence

MAEGGAADLDTQRSDIATLLKTSLRKGDTWYLVDSRWFKQWKKYVGFDSWDKYQMGDQNVYPGPIDNSGL      1 - 70
LKDGDAQSLKEHLIDELDYILLPTEGWNKLVSWYTLMEGQEPIARKVVEQGMFVKHCKVEVYLTELKLCE     71 - 140
NGNMNNVVTRRFSKADTIDTIEKEIRKIFSIPDEKETRLWNKYMSNTFEPLNKPDSTIQDAGLYQGQVLV    141 - 210
IEQKNEDGTWPRGPSTPKSPGASNFSTLPKISPSSLSNNYNNMNNRNVKNSNYCLPSYTAYKNYDYSEPG    211 - 280
RNNEQPGLCGLSNLGNTCFMNSAIQCLSNTPPLTEYFLNDKYQEELNFDNPLGMRGEIAKSYAELIKQMW    281 - 350
SGKFSYVTPRAFKTQVGRFAPQFSGYQQQDCQELLAFLLDGLHEDLNRIRKKPYIQLKDADGRPDKVVAE    351 - 420
EAWENHLKRNDSIIVDIFHGLFKSTLVCPECAKISVTFDPFCYLTLPLPMKKERTLEVYLVRMDPLTKPM    421 - 490
QYKVVVPKIGNILDLCTALSALSGIPADKMIVTDIYNHRFHRIFAMDENLSSIMERDDIYVFEININRTE    491 - 560
DTEHVIIPVCLREKFRHSSYTHHTGSSLFGQPFLMAVPRNNTEDKLYNLLLLRMCRYVKISTETEETEGS    561 - 630
LHCCKDQNINGNGPNGIHEEGSPSEMETDEPDDESSQDQELPSENENSQSEDSVGGDNDSENGLCTEDTC    631 - 700
KGQLTGHKKRLFTFQFNNLGNTDINYIKDDTRHIRFDDRQLRLDERSFLALDWDPDLKKRYFDENAAEDF    701 - 770
EKHESVEYKPPKKPFVKLKDCIELFTTKEKLGAEDPWYCPNCKEHQQATKKLDLWSLPPVLVVHLKRFSY    771 - 840
SRYMRDKLDTLVDFPINDLDMSEFLINPNAGPCRYNLIAVSNHYGGMGGGHYTAFAKNKDDGKWYYFDDS    841 - 910
SVSTASEDQIVSKAAYVLFYQRQDTFSGTGFFPLDRETKGASAATGIPLESDEDSNDNDNDIENENCMHT    911 - 980
N//

Text Mined References (49)

PMID Year Title
26435193 2015 USP15 regulates SMURF2 kinetics through C-lobe mediated deubiquitination.
26061460 2015 Ubiquitin-specific Protease 15 Negatively Regulates Virus-induced Type I Interferon Signaling via Catalytically-dependent and -independent Mechanisms.
25416956 2014 A proteome-scale map of the human interactome network.
24939309 2014 Expression of USP15, T?R-I and Smad7 in psoriasis.
24852371 2014 The deubiquitinase USP15 antagonizes Parkin-mediated mitochondrial ubiquitination and mitophagy.
24850914 2014 USP15 targets ALK3/BMPR1A for deubiquitylation to enhance bone morphogenetic protein signalling.
24777531 2014 USP15 stabilizes MDM2 to mediate cancer-cell survival and inhibit antitumor T cell responses.
24526689 2014 The U4/U6 recycling factor SART3 has histone chaperone activity and associates with USP15 to regulate H2B deubiquitination.
24399297 2014 The ubiquitin-specific protease USP15 promotes RIG-I-mediated antiviral signaling by deubiquitylating TRIM25.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
More...