Property Summary

NCBI Gene PubMed Count 43
PubMed Score 41.64
PubTator Score 23.68

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (16)

Disease log2 FC p
adult high grade glioma -1.200 3.4e-03
Astrocytoma, Pilocytic 1.500 8.2e-07
Atopic dermatitis -1.300 1.3e-05
atypical teratoid / rhabdoid tumor -2.000 2.5e-07
ependymoma -1.400 6.1e-07
glioblastoma 1.500 6.9e-09
hereditary spastic paraplegia -1.071 4.1e-03
lung cancer -1.300 2.4e-04
malignant mesothelioma -1.300 9.3e-07
medulloblastoma 1.200 8.6e-04
medulloblastoma, large-cell -1.800 7.2e-07
osteosarcoma -1.132 3.5e-02
ovarian cancer -1.100 9.1e-07
primitive neuroectodermal tumor 1.300 3.4e-03
urothelial carcinoma -1.100 3.5e-03
Waldenstrons macroglobulinemia -1.267 1.1e-02

Gene RIF (28)

AA Sequence

MAEGGAADLDTQRSDIATLLKTSLRKGDTWYLVDSRWFKQWKKYVGFDSWDKYQMGDQNVYPGPIDNSGL      1 - 70
LKDGDAQSLKEHLIDELDYILLPTEGWNKLVSWYTLMEGQEPIARKVVEQGMFVKHCKVEVYLTELKLCE     71 - 140
NGNMNNVVTRRFSKADTIDTIEKEIRKIFSIPDEKETRLWNKYMSNTFEPLNKPDSTIQDAGLYQGQVLV    141 - 210
IEQKNEDGTWPRGPSTPKSPGASNFSTLPKISPSSLSNNYNNMNNRNVKNSNYCLPSYTAYKNYDYSEPG    211 - 280
RNNEQPGLCGLSNLGNTCFMNSAIQCLSNTPPLTEYFLNDKYQEELNFDNPLGMRGEIAKSYAELIKQMW    281 - 350
SGKFSYVTPRAFKTQVGRFAPQFSGYQQQDCQELLAFLLDGLHEDLNRIRKKPYIQLKDADGRPDKVVAE    351 - 420
EAWENHLKRNDSIIVDIFHGLFKSTLVCPECAKISVTFDPFCYLTLPLPMKKERTLEVYLVRMDPLTKPM    421 - 490
QYKVVVPKIGNILDLCTALSALSGIPADKMIVTDIYNHRFHRIFAMDENLSSIMERDDIYVFEININRTE    491 - 560
DTEHVIIPVCLREKFRHSSYTHHTGSSLFGQPFLMAVPRNNTEDKLYNLLLLRMCRYVKISTETEETEGS    561 - 630
LHCCKDQNINGNGPNGIHEEGSPSEMETDEPDDESSQDQELPSENENSQSEDSVGGDNDSENGLCTEDTC    631 - 700
KGQLTGHKKRLFTFQFNNLGNTDINYIKDDTRHIRFDDRQLRLDERSFLALDWDPDLKKRYFDENAAEDF    701 - 770
EKHESVEYKPPKKPFVKLKDCIELFTTKEKLGAEDPWYCPNCKEHQQATKKLDLWSLPPVLVVHLKRFSY    771 - 840
SRYMRDKLDTLVDFPINDLDMSEFLINPNAGPCRYNLIAVSNHYGGMGGGHYTAFAKNKDDGKWYYFDDS    841 - 910
SVSTASEDQIVSKAAYVLFYQRQDTFSGTGFFPLDRETKGASAATGIPLESDEDSNDNDNDIENENCMHT    911 - 980
N//

Text Mined References (58)

PMID Year Title