Property Summary

NCBI Gene PubMed Count 11
PubMed Score 114.34
PubTator Score 20.21

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (14)

Disease log2 FC p
adult high grade glioma -1.700 2.2e-06
astrocytic glioma -1.700 1.9e-03
Astrocytoma, Pilocytic -1.300 9.3e-09
atypical teratoid / rhabdoid tumor -2.100 5.4e-09
ependymoma -2.100 1.6e-03
glioblastoma -1.600 6.1e-10
group 3 medulloblastoma -1.100 3.8e-04
lung cancer 1.100 6.7e-04
lung carcinoma 2.200 5.5e-54
medulloblastoma, large-cell -2.300 4.7e-06
oligodendroglioma -1.400 1.1e-02
ovarian cancer -1.400 2.1e-09
primitive neuroectodermal tumor -1.400 1.4e-04
psoriasis 1.200 5.3e-04

Synonym

Accession Q9Y4E6 A7E2C8 Q86UX5 Q86VP2 Q96PS7
Symbols TRAG

Gene

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MAGNSLVLPIVLWGRKAPTHCISAVLLTDDGATIVTGCHDGQICLWDLSVELQINPRALLFGHTASITCL      1 - 70
SKACASSDKQYIVSASESGEMCLWDVSDGRCIEFTKLACTHTGIQFYQFSVGNQREGRLLCHGHYPEILV     71 - 140
VDATSLEVLYSLVSKISPDWISSMSIIRSHRTQEDTVVALSVTGILKVWIVTSEISDMQDTEPIFEEESK    141 - 210
PIYCQNCQSISFCAFTQRSLLVVCSKYWRVFDAGDYSLLCSGPSENGQTWTGGDFVSSDKVIIWTENGQS    211 - 280
YIYKLPASCLPASDSFRSDVGKAVENLIPPVQHILLDRKDKELLICPPVTRFFYGCREYFHKLLIQGDSS    281 - 350
GRLNIWNISDTADKQGSEEGLAMTTSISLQEAFDKLNPCPAGIIDQLSVIPNSNEPLKVTASVYIPAHGR    351 - 420
LVCGREDGSIVIVPATQTAIVQLLQGEHMLRRGWPPHRTLRGHRNKVTCLLYPHQVSARYDQRYLISGGV    421 - 490
DFSVIIWDIFSGEMKHIFCVHGGEITQLLVPPENCSARVQHCICSVASDHSVGLLSLREKKCIMLASRHL    491 - 560
FPIQVIKWRPSDDYLVVGCSDGSVYVWQMDTGALDRCVMGITAVEILNACDEAVPAAVDSLSHPAVNLKQ    561 - 630
AMTRRSLAALKNMAHHKLQTLATNLLASEASDKGNLPKYSHNSLMVQAIKTNLTDPDIHVLFFDVEALII    631 - 700
QLLTEEASRPNTALISPENLQKASGSSDKGGSFLTGKRAAVLFQQVKETIKENIKEHLLDDEEEDEEIMR    701 - 770
QRREESDPEYRSSKSKPLTLLEYNLTMDTAKLFMSCLHAWGLNEVLDEVCLDRLGMLKPHCTVSFGLLSR    771 - 840
GGHMSLMLPGYNQPACKLSHGKTEVGRKLPASEGVGKGTYGVSRAVTTQHLLSIISLANTLMSMTNATFI    841 - 910
GDHMKKGPTRPPRPSTPDLSKARGSPPTSSNIVQGQIKQVAAPVVSARSDADHSGSDPPSAPALHTCFLV    911 - 980
NEGWSQLAAMHCVMLPDLLGLDKFRPPLLEMLARRWQDRCLEVREAAQALLLAELRRIEQAGRKEAIDAW    981 - 1050
APYLPQYIDHVISPGVTSEAAQTITTAPDASGPEAKVQEEEHDLVDDDITTGCLSSVPQMKKISTSYEER   1051 - 1120
RKQATAIVLLGVIGAEFGAEIEPPKLLTRPRSSSQIPEGFGLTSGGSNYSLARHTCKALTFLLLQPPSPK   1121 - 1190
LPPHSTIRRTAIDLIGRGFTVWEPYMDVSAVLMGLLELCADAEKQLANITMGLPLSPAADSARSARHALS   1191 - 1260
LIATARPPAFITTIAKEVHRHTALAANTQSQQNMHTTTLARAKGEILRVIEILIEKMPTDVVDLLVEVMD   1261 - 1330
IIMYCLEGSLVKKKGLQECFPAICRFYMVSYYERNHRIAVGARHGSVALYDIRTGKCQTIHGHKGPITAV   1331 - 1400
AFAPDGRYLATYSNTDSHISFWQMNTSLLGSIGMLNSAPQLRCIKTYQVPPVQPASPGSHNALKLARLIW   1401 - 1470
TSNRNVILMAHDGKEHRFMV                                                     1471 - 1490
//

Text Mined References (14)

PMID Year Title