Property Summary

NCBI Gene PubMed Count 19
PubMed Score 254.42
PubTator Score 3.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
acute myeloid leukemia 1.100 1.2e-02
acute quadriplegic myopathy 1.034 4.1e-06
astrocytic glioma 1.800 7.8e-03
dermatomyositis 1.600 6.0e-04
ependymoma 1.700 2.0e-02
intraductal papillary-mucinous adenoma (... 1.500 7.3e-03
intraductal papillary-mucinous carcinoma... 1.600 7.9e-03
Multiple myeloma 1.523 1.3e-02
oligodendroglioma 1.800 1.3e-02
osteosarcoma 2.795 1.4e-04
ovarian cancer -1.400 7.4e-06
Pick disease -1.400 6.5e-04
pituitary cancer -1.400 6.9e-05
progressive supranuclear palsy -1.600 1.2e-02
psoriasis -1.500 1.1e-04
Rheumatoid arthritis 1.900 1.4e-02
tuberculosis -1.500 2.3e-04

Gene RIF (3)

AA Sequence

MGDPGSEIIESVPPAGPEASESTTDENEDDIQFVSEGPLRPVLEYIDLVSSDDEEPSTSYTDENIKRKDH      1 - 70
IDYQKDKVALTLARLARHVEVEKQQKEEKNRAFREKIDFQHAHGLQELEFIRGHSDTEAARLCVDQWLKM     71 - 140
PGLKTGTINCGTKSSFRRGGHTWVSGKPILCPIMHCNKEFDNGHLLLGHLKRFDHSPCDPTITLHGPFFS    141 - 210
SFACVVCYKKFVTQQQYRDHLFDKEATDDGHNNNLLPQIIQCFACPNCFLLFSRKEECSKHMSGKNHFHQ    211 - 280
SFKLGDNKGIAHPISFPSFAKKLLISLCKDVPFQVKCVACHKTLRSHMELTAHFRVHCRNAGPVAVAEKS    281 - 350
ITQVAEKFILRGYCPDCNQVFVDETSTQNHKQNSGHKVRVINSVEESVLLYCHSSEGNKDPSSDLHLLLD    351 - 420
QSKFSSLKRTMSIKESSSLECIAIPKKKMNLKDKSHEGVACVQKEKSVVKTWFCECNQRFPSEDAVEKHV    421 - 490
FSANTMGYKCVVCGKVCDDSGVIRLHMSRIHGGAHLNNFLFWCRTCKKELTRKDTIMAHVTEFHNGHRYF    491 - 560
YEMDEVEGETLPSSSTTLDNLTANKPSSAITVIDHSPANSSPRGKWQCRICEDMFDSQEYVKQHCMSLAS    561 - 630
HKFHRYSCAHCRKPFHKIETLYRHCQDEHDNEIKIKYFCGLCDLIFNVEEAFLSHYEEHHSIDYVFVSEK    631 - 700
TETSIKTEDDFPVIETSNQLTCGCRESYICKVNRKEDYSRCLQIMLDKGKLWFRCSLCSATAQNLTDMNT    701 - 770
HIHQVHKEKSDEEEQQYVIKCGTCTKAFHDPESAQQHFHRKHCFLQKPSVAHFGSEKSNLYKFTASASHT    771 - 840
ERKLKQAINYSKSLDMEKGVENDLSYQNIEEEIVELPDLDYLRTMTHIVFVDFDNWSNFFGHLPGHLNQG    841 - 910
TFIWGFQGGNTNWKPPLNCKIYNYLNRIGCFFLHPRCSKRKDAADFAICMHAGRLDEQLPKQIPFTILSG    911 - 980
DQGFLELENQFKKTQRPAHILNPHHLEGDMMCALLNSISDTTKECDSDDNMGAKNTSIGEEFISTEDVEL    981 - 1050
EEAIRRSLEEM                                                              1051 - 1061
//

Text Mined References (27)

PMID Year Title