Property Summary

NCBI Gene PubMed Count 19
Grant Count 5
R01 Count 5
Funding $649,982
PubMed Score 246.65
PubTator Score 3.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (17)

Disease log2 FC p
Rheumatoid Arthritis 1.900 0.014
Multiple myeloma 1.523 0.013
astrocytic glioma 1.800 0.008
ependymoma 1.700 0.020
oligodendroglioma 1.800 0.013
psoriasis -1.500 0.000
osteosarcoma 2.795 0.000
acute quadriplegic myopathy 1.034 0.000
tuberculosis -1.500 0.000
intraductal papillary-mucinous adenoma (... 1.500 0.007
intraductal papillary-mucinous carcinoma... 1.600 0.008
acute myeloid leukemia 1.100 0.012
Pick disease -1.400 0.001
progressive supranuclear palsy -1.600 0.012
ovarian cancer 2.000 0.000
pituitary cancer -1.400 0.000
dermatomyositis 1.600 0.001

Gene RIF (3)

PMID Text
26524494 The authors show that ZNF451 is SUMO2 specific and that SUMO modification of ZNF451 may contribute to activity by providing a second molecule of SUMO that interacts with E2.
24324267 ZNF451 acts as a transcriptional corepressor for Smad3/4 and negatively regulates TGF-beta signaling.
18656483 Data describe ZNF451, a nuclear protein that can be associated with promyelocytic leukemia bodies, and exerts its effects via SUMO modification machinery and trafficking of transcription regulators between promyelocytic leukemia bodies and nucleoplasm.

AA Sequence

MGDPGSEIIESVPPAGPEASESTTDENEDDIQFVSEGPLRPVLEYIDLVSSDDEEPSTSYTDENIKRKDH      1 - 70
IDYQKDKVALTLARLARHVEVEKQQKEEKNRAFREKIDFQHAHGLQELEFIRGHSDTEAARLCVDQWLKM     71 - 140
PGLKTGTINCGTKSSFRRGGHTWVSGKPILCPIMHCNKEFDNGHLLLGHLKRFDHSPCDPTITLHGPFFS    141 - 210
SFACVVCYKKFVTQQQYRDHLFDKEATDDGHNNNLLPQIIQCFACPNCFLLFSRKEECSKHMSGKNHFHQ    211 - 280
SFKLGDNKGIAHPISFPSFAKKLLISLCKDVPFQVKCVACHKTLRSHMELTAHFRVHCRNAGPVAVAEKS    281 - 350
ITQVAEKFILRGYCPDCNQVFVDETSTQNHKQNSGHKVRVINSVEESVLLYCHSSEGNKDPSSDLHLLLD    351 - 420
QSKFSSLKRTMSIKESSSLECIAIPKKKMNLKDKSHEGVACVQKEKSVVKTWFCECNQRFPSEDAVEKHV    421 - 490
FSANTMGYKCVVCGKVCDDSGVIRLHMSRIHGGAHLNNFLFWCRTCKKELTRKDTIMAHVTEFHNGHRYF    491 - 560
YEMDEVEGETLPSSSTTLDNLTANKPSSAITVIDHSPANSSPRGKWQCRICEDMFDSQEYVKQHCMSLAS    561 - 630
HKFHRYSCAHCRKPFHKIETLYRHCQDEHDNEIKIKYFCGLCDLIFNVEEAFLSHYEEHHSIDYVFVSEK    631 - 700
TETSIKTEDDFPVIETSNQLTCGCRESYICKVNRKEDYSRCLQIMLDKGKLWFRCSLCSATAQNLTDMNT    701 - 770
HIHQVHKEKSDEEEQQYVIKCGTCTKAFHDPESAQQHFHRKHCFLQKPSVAHFGSEKSNLYKFTASASHT    771 - 840
ERKLKQAINYSKSLDMEKGVENDLSYQNIEEEIVELPDLDYLRTMTHIVFVDFDNWSNFFGHLPGHLNQG    841 - 910
TFIWGFQGGNTNWKPPLNCKIYNYLNRIGCFFLHPRCSKRKDAADFAICMHAGRLDEQLPKQIPFTILSG    911 - 980
DQGFLELENQFKKTQRPAHILNPHHLEGDMMCALLNSISDTTKECDSDDNMGAKNTSIGEEFISTEDVEL    981 - 1050
EEAIRRSLEEM                                                              1051 - 1061
//

Text Mined References (26)

PMID Year Title
26524494 2015 Structural basis for catalytic activation by the human ZNF451 SUMO E3 ligase.
26524493 2015 A new vertebrate SUMO enzyme family reveals insights into SUMO-chain assembly.
25772364 2015 SUMO-2 Orchestrates Chromatin Modifiers in Response to DNA Damage.
25755297 2015 System-wide Analysis of SUMOylation Dynamics in Response to Replication Stress Reveals Novel Small Ubiquitin-like Modified Target Proteins and Acceptor Lysines Relevant for Genome Stability.
25218447 2014 Uncovering global SUMOylation signaling networks in a site-specific manner.
25114211 2014 Mapping of SUMO sites and analysis of SUMOylation changes induced by external stimuli.
24324267 2014 Zinc finger protein 451 is a novel Smad corepressor in transforming growth factor-? signaling.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21516116 2011 Next-generation sequencing to generate interactome datasets.
More...