Property Summary

NCBI Gene PubMed Count 26
PubMed Score 40.89
PubTator Score 26.11

Knowledge Summary


No data available


  Disease Sources (4)

Disease Target Count P-value
malignant mesothelioma 3163 1.49894972834892E-9
Breast cancer 3099 8.52848065798968E-9
ovarian cancer 8492 2.13215893715235E-7
ulcerative colitis 2087 2.56765849409706E-5
cystic fibrosis 1670 1.18366593381903E-4
group 4 medulloblastoma 1875 2.62047365826584E-4
interstitial cystitis 2299 4.90384000412575E-4
medulloblastoma, large-cell 6234 7.55858755597876E-4
gastric carcinoma 832 0.00872740702079142
astrocytoma 1493 0.0219068962008719
colon cancer 1475 0.0278954319626138
subependymal giant cell astrocytoma 2287 0.047338281070306
Disease Target Count Z-score Confidence
Carcinoma 2147 0.0 1.0


  Differential Expression (12)

Disease log2 FC p
malignant mesothelioma 5.400 0.000
cystic fibrosis -1.129 0.000
astrocytoma 1.100 0.022
medulloblastoma, large-cell -1.500 0.001
colon cancer 1.200 0.028
interstitial cystitis 1.100 0.000
group 4 medulloblastoma -1.700 0.000
subependymal giant cell astrocytoma 1.610 0.047
Breast cancer 1.300 0.000
gastric carcinoma 1.200 0.009
ulcerative colitis 1.100 0.000
ovarian cancer 2.300 0.000


Accession Q9Y4D7 A7E2C6 C9JPZ6 Q6PJS9 Q8IZJ2 Q9BTQ2
Symbols PLEXD1




  Ortholog (7)

Species Source
Mouse OMA EggNOG Inparanoid
Rat OMA Inparanoid
Cow OMA EggNOG Inparanoid
Opossum OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG Inparanoid

Gene RIF (17)

26648031 Plexin D1 plays a role in collagen contraction in human lung fibroblasts.
26292963 Findings suggest that Plexin-D1/class III semaphorin (Sema3E) axis is triggered in systemic sclerosis (SSc) endothelium.
26068067 finding that PLXND1 and REV3L mutations are responsible for a proportion of MBS patients suggests that de novo mutations in other genes might account for other MBS patients
25976775 The data indicate that Plexin-D1 operates in a cell context-specific fashion, mediating different synaptogenic outcomes depending upon neuron type.
25831505 Plxnd1 is a novel regulator of VAT growth, body fat distribution, and insulin sensitivity in both zebrafish and humans
24841563 The identification and characterization of SH3BP1 as a novel downstream effector of Sema3E-PlexinD1 provides an explanation for how extracellular signals are translated into cytoskeletal changes and unique cell behavior.
24254849 It is therefore suggested that SEMA3C signaling, propagated through the heterodimer receptor plexin-D1/neuropilin, is important for truncus arteriosus septation
24139859 A critical role of Sema3E/Plexin D1 interaction in tumor resistance to apoptosis.
22738647 Strong expression of plexD1 was detected in endothelial cells of cervical cancer samples, yet no expression was seen in endothelial cells of normal cervical tissues, which suggests a potential role of PlexD1 in cervical cancer-associated angiogenesis
21795701 a novel phospholipid-regulated antiangiogenic signaling pathway whereby Sema3E activates Arf6 through Plexin-D1 and consequently controls integrin-mediated endothelial cell attachment to the extracellular matrix and migration.

AA Sequence

ALEANPTARRTQLQHKFEQVVALMEDNIYECYSEA                                      1891 - 1925

Text Mined References (28)

PMID Year Title
26648031 2015 Semaphorin 4A enhances lung fibrosis through activation of Akt via PlexinD1 receptor.
26292963 2015 Plexin-D1/Semaphorin 3E pathway may contribute to dysregulation of vascular tone control and defective angiogenesis in systemic sclerosis.
26068067 2015 De novo mutations in PLXND1 and REV3L cause Möbius syndrome.
25976775 2015 Positive regulation of neocortical synapse formation by the Plexin-D1 receptor.
25831505 2015 Plexin D1 determines body fat distribution by regulating the type V collagen microenvironment in visceral adipose tissue.
24841563 2014 An image-based RNAi screen identifies SH3BP1 as a key effector of Semaphorin 3E-PlexinD1 signaling.
24254849 2013 Isolated truncus arteriosus associated with a mutation in the plexin-D1 gene.
24139859 2013 Semaphorin 3E suppresses tumor cell death triggered by the plexin D1 dependence receptor in metastatic breast cancers.
22738647 2012 Plexin D1: new potential biomarker for cervical cancer.
21795701 2011 Phosphatidylinositol-4-phosphate 5-kinase and GEP100/Brag2 protein mediate antiangiogenic signaling by semaphorin 3E-plexin-D1 through Arf6 protein.