Property Summary

NCBI Gene PubMed Count 12
Grant Count 18
Funding $1,045,604.42
PubMed Score 11.22
PubTator Score 18.75

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (1)

Disease log2 FC p
lung carcinoma 1.800 0.000

Gene RIF (4)

PMID Text
24616451 In subcutaneous adipose tissue, DAGL-a mRNA was upregulated and fatty acid amide hydrolase (FAAH) and monoacylglycerol lipase (MAGL) mRNAs were down-regulated in obese subjects, but the diets had no influence.
24076015 PLC-beta1 and DAGL-alpha are detected in discrete brain regions, with a marked predominance of pyramidal morphologies of positive cortical cells.[review]
22827915 DAGLalpha mRNA expression is lowest in early life and adulthood, peaking between school age and young adulthood.
14610053 This gene was functionally characterized as a diacylglycerol-lipase (DAGL), specifically referred to as DAGL alpha. This enzyme may play a role in the biosynthesis of the endocannbinoid 2-arachidonoylglycerol (2-AG).

AA Sequence

MPGIVVFRRRWSVGSDDLVLPAIFLFLLHTTWFVILSVVLFGLVYNPHEACSLNLVDHGRGYLGILLSCM      1 - 70
IAEMAIIWLSMRGGILYTEPRDSMQYVLYVRLAILVIEFIYAIVGIVWLTQYYTSCNDLTAKNVTLGMVV     71 - 140
CNWVVILSVCITVLCVFDPTGRTFVKLRATKRRQRNLRTYNLRHRLEEGQATSWSRRLKVFLCCTRTKDS    141 - 210
QSDAYSEIAYLFAEFFRDLDIVPSDIIAGLVLLRQRQRAKRNAVLDEANNDILAFLSGMPVTRNTKYLDL    211 - 280
KNSQEMLRYKEVCYYMLFALAAYGWPMYLMRKPACGLCQLARSCSCCLCPARPRFAPGVTIEEDNCCGCN    281 - 350
AIAIRRHFLDENMTAVDIVYTSCHDAVYETPFYVAVDHDKKKVVISIRGTLSPKDALTDLTGDAERLPVE    351 - 420
GHHGTWLGHKGMVLSAEYIKKKLEQEMVLSQAFGRDLGRGTKHYGLIVVGHSLGAGTAAILSFLLRPQYP    421 - 490
TLKCFAYSPPGGLLSEDAMEYSKEFVTAVVLGKDLVPRIGLSQLEGFRRQLLDVLQRSTKPKWRIIVGAT    491 - 560
KCIPKSELPEEVEVTTLASTRLWTHPSDLTIALSASTPLYPPGRIIHVVHNHPAEQCCCCEQEEPTYFAI    561 - 630
WGDNKAFNEVIISPAMLHEHLPYVVMEGLNKVLENYNKGKTALLSAAKVMVSPTEVDLTPELIFQQQPLP    631 - 700
TGPPMPTGLALELPTADHRNSSVRSKSQSEMSLEGFSEGRLLSPVVAAAARQDPVELLLLSTQERLAAEL    701 - 770
QARRAPLATMESLSDTESLYSFDSRRSSGFRSIRGSPSLHAVLERDEGHLFYIDPAIPEENPSLSSRTEL    771 - 840
LAADSLSKHSQDTQPLEAALGSGGVTPERPPSAAANDEEEEVGGGGGGPASRGELALHNGRLGDSPSPQV    841 - 910
LEFAEFIDSLFNLDSKSSSFQDLYCMVVPESPTSDYAEGPKSPSQQEILLRAQFEPNLVPKPPRLFAGSA    911 - 980
DPSSGISLSPSFPLSSSGELMDLTPTGLSSQECLAADKIRTSTPTGHGASPAKQDELVISAR            981 - 1042
//

Text Mined References (13)

PMID Year Title
24823311 2014 Genome-wide association study of plasma N6 polyunsaturated fatty acids within the cohorts for heart and aging research in genomic epidemiology consortium.
24616451 2014 Influence of dietary fat intake on the endocannabinoid system in lean and obese subjects.
24076015 2014 Nuclear phospholipase C-?1 and diacylglycerol LIPASE-? in brain cortical neurons.
22827915 2012 Developmental trajectory of the endocannabinoid system in human dorsolateral prefrontal cortex.
22610502 2012 Genome-wide analysis of polymorphisms associated with cytokine responses in smallpox vaccine recipients.
21829377 2011 Genetic loci associated with plasma phospholipid n-3 fatty acids: a meta-analysis of genome-wide association studies from the CHARGE Consortium.
18801880 2008 A duplication at chromosome 11q12.2-11q12.3 is associated with spinocerebellar ataxia type 20.
16051747 2005 Stimulation of endocannabinoid formation in brain slice cultures through activation of group I metabotropic glutamate receptors.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14610053 2003 Cloning of the first sn1-DAG lipases points to the spatial and temporal regulation of endocannabinoid signaling in the brain.
More...