Property Summary

NCBI Gene PubMed Count 32
PubMed Score 30.85
PubTator Score 23.61

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (20)

Disease log2 FC p
acute quadriplegic myopathy 1.101 3.2e-04
Astrocytoma, Pilocytic -1.100 2.0e-03
atypical teratoid / rhabdoid tumor -1.200 1.3e-02
Breast cancer -1.400 1.3e-11
colon cancer -1.500 2.8e-02
cutaneous lupus erythematosus -1.200 3.4e-03
dermatomyositis 1.200 1.4e-03
Duchenne muscular dystrophy 1.020 1.4e-07
glioblastoma -1.400 1.4e-03
intraductal papillary-mucinous adenoma (... 1.100 1.6e-02
intraductal papillary-mucinous carcinoma... 1.200 1.1e-02
malignant mesothelioma -1.100 1.0e-05
medulloblastoma, large-cell -1.100 3.5e-05
osteosarcoma -1.693 3.1e-03
ovarian cancer -2.100 1.2e-04
Pick disease 1.300 9.2e-05
Rheumatoid arthritis 1.600 2.6e-02
sonic hedgehog group medulloblastoma 1.400 1.0e-03
spina bifida -1.564 2.9e-02
tuberculosis -1.100 1.3e-06

 GWAS Trait (1)

Gene RIF (17)

AA Sequence

MAPRKRGGRGISFIFCCFRNNDHPEITYRLRNDSNFALQTMEPALPMPPVEELDVMFSELVDELDLTDKH      1 - 70
REAMFALPAEKKWQIYCSKKKDQEENKGATSWPEFYIDQLNSMAARKSLLALEKEEEEERSKTIESLKTA     71 - 140
LRTKPMRFVTRFIDLDGLSCILNFLKTMDYETSESRIHTSLIGCIKALMNNSQGRAHVLAHSESINVIAQ    141 - 210
SLSTENIKTKVAVLEILGAVCLVPGGHKKVLQAMLHYQKYASERTRFQTLINDLDKSTGRYRDEVSLKTA    211 - 280
IMSFINAVLSQGAGVESLDFRLHLRYEFLMLGIQPVIDKLREHENSTLDRHLDFFEMLRNEDELEFAKRF    281 - 350
ELVHIDTKSATQMFELTRKRLTHSEAYPHFMSILHHCLQMPYKRSGNTVQYWLLLDRIIQQIVIQNDKGQ    351 - 420
DPDSTPLENFNIKNVVRMLVNENEVKQWKEQAEKMRKEHNELQQKLEKKERECDAKTQEKEEMMQTLNKM    421 - 490
KEKLEKETTEHKQVKQQVADLTAQLHELSRRAVCASIPGGPSPGAPGGPFPSSVPGSLLPPPPPPPLPGG    491 - 560
MLPPPPPPLPPGGPPPPPGPPPLGAIMPPPGAPMGLALKKKSIPQPTNALKSFNWSKLPENKLEGTVWTE    561 - 630
IDDTKVFKILDLEDLERTFSAYQRQQDFFVNSNSKQKEADAIDDTLSSKLKVKELSVIDGRRAQNCNILL    631 - 700
SRLKLSNDEIKRAILTMDEQEDLPKDMLEQLLKFVPEKSDIDLLEEHKHELDRMAKADRFLFEMSRINHY    701 - 770
QQRLQSLYFKKKFAERVAEVKPKVEAIRSGSEEVFRSGALKQLLEVVLAFGNYMNKGQRGNAYGFKISSL    771 - 840
NKIADTKSSIDKNITLLHYLITIVENKYPSVLNLNEELRDIPQAAKVNMTELDKEISTLRSGLKAVETEL    841 - 910
EYQKSQPPQPGDKFVSVVSQFITVASFSFSDVEDLLAEAKDLFTKAVKHFGEEAGKIQPDEFFGIFDQFL    911 - 980
QAVSEAKQENENMRKKKEEEERRARMEAQLKEQRERERKMRKAKENSEESGEFDDLVSALRSGEVFDKDL    981 - 1050
SKLKRNRKRITNQMTDSSRERPITKLNF                                             1051 - 1078
//

Text Mined References (35)

PMID Year Title