Property Summary

NCBI Gene PubMed Count 28
PubMed Score 27.55
PubTator Score 23.61

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (2)

Disease Target Count P-value
Breast cancer 3099 1.32232894611871E-11
Duchenne muscular dystrophy 602 1.38837104144704E-7
tuberculosis 1563 1.32017356217125E-6
malignant mesothelioma 3163 9.99339588202752E-6
medulloblastoma, large-cell 6234 3.48899110061694E-5
Pick disease 1893 9.18575365426959E-5
ovarian cancer 8492 1.183300138309E-4
atypical teratoid / rhabdoid tumor 4369 2.6666211444619E-4
acute quadriplegic myopathy 1157 3.15668771580482E-4
sonic hedgehog group medulloblastoma 1482 9.95209121729365E-4
pilocytic astrocytoma 3086 0.00137102164523382
dermatomyositis 967 0.00140108764248812
glioblastoma 5572 0.00140266347165367
osteosarcoma 7933 0.00312347315669056
cutaneous lupus erythematosus 1056 0.00336445076227688
intraductal papillary-mucinous carcinoma (IPMC) 2988 0.0111988119882262
intraductal papillary-mucinous adenoma (IPMA) 2956 0.0155414365684015
Rheumatoid Arthritis 1171 0.0261667090029741
colon cancer 1475 0.027942048348742
spina bifida 1064 0.0294440173606223
Disease Target Count Z-score Confidence
Chondrosarcoma 24 3.267 1.6

Expression

  Differential Expression (20)

Synonym

Accession Q9Y4D1 Q86U34 Q8N1Z8 Q8TB39
Symbols

Gene

PDB

2J1D   2Z6E  

  Ortholog (10)

Species Source
Chimp OMA Inparanoid
Macaque OMA Inparanoid
Mouse OMA Inparanoid
Rat OMA Inparanoid
Dog OMA Inparanoid
Horse OMA Inparanoid
Cow OMA Inparanoid
Pig OMA Inparanoid
Xenopus OMA Inparanoid
Zebrafish OMA Inparanoid

 GWAS Trait (1)

Gene RIF (13)

PMID Text
24696301 Daam1 plays a dual role in the phagocytic uptake of borreliae.
22869791 A developmentally restricted function of miR-490 and its putative DAAM1 target are associated with exaggerated megakaryocytopoiesis and/or proplatelet formation.
22655072 Wnt5a promotes breast cancer cell migration via Dvl2/Daam1/RhoA.
20927366 DAAM1 is a formin required for centrosome re-orientation during cell migration.
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
20351293 DAAM1 regulates endothelial cell growth through MT stabilization in a cell type-selective manner
20223827 Fli-I promotes the GTP-bound active Rho-mediated relief of the autoinhibition of Daam1 and mDia1. Thus, Fli-I is a novel positive regulator of Rho-induced linear actin assembly mediated by DRFs.
18218625 mDia1 and Daam1 are platelet actin assembly factors having distinct efficiencies, and they are directly regulated by Rho GTPases
18162551 a carboxyl-terminal binding partner, Dvl, has a role in activation of Daam1
17986009 Crystal structure of human DAAM1 formin homology 2 domain
More...

AA Sequence

MAPRKRGGRGISFIFCCFRNNDHPEITYRLRNDSNFALQTMEPALPMPPVEELDVMFSELVDELDLTDKH      1 - 70
REAMFALPAEKKWQIYCSKKKDQEENKGATSWPEFYIDQLNSMAARKSLLALEKEEEEERSKTIESLKTA     71 - 140
LRTKPMRFVTRFIDLDGLSCILNFLKTMDYETSESRIHTSLIGCIKALMNNSQGRAHVLAHSESINVIAQ    141 - 210
SLSTENIKTKVAVLEILGAVCLVPGGHKKVLQAMLHYQKYASERTRFQTLINDLDKSTGRYRDEVSLKTA    211 - 280
IMSFINAVLSQGAGVESLDFRLHLRYEFLMLGIQPVIDKLREHENSTLDRHLDFFEMLRNEDELEFAKRF    281 - 350
ELVHIDTKSATQMFELTRKRLTHSEAYPHFMSILHHCLQMPYKRSGNTVQYWLLLDRIIQQIVIQNDKGQ    351 - 420
DPDSTPLENFNIKNVVRMLVNENEVKQWKEQAEKMRKEHNELQQKLEKKERECDAKTQEKEEMMQTLNKM    421 - 490
KEKLEKETTEHKQVKQQVADLTAQLHELSRRAVCASIPGGPSPGAPGGPFPSSVPGSLLPPPPPPPLPGG    491 - 560
MLPPPPPPLPPGGPPPPPGPPPLGAIMPPPGAPMGLALKKKSIPQPTNALKSFNWSKLPENKLEGTVWTE    561 - 630
IDDTKVFKILDLEDLERTFSAYQRQQDFFVNSNSKQKEADAIDDTLSSKLKVKELSVIDGRRAQNCNILL    631 - 700
SRLKLSNDEIKRAILTMDEQEDLPKDMLEQLLKFVPEKSDIDLLEEHKHELDRMAKADRFLFEMSRINHY    701 - 770
QQRLQSLYFKKKFAERVAEVKPKVEAIRSGSEEVFRSGALKQLLEVVLAFGNYMNKGQRGNAYGFKISSL    771 - 840
NKIADTKSSIDKNITLLHYLITIVENKYPSVLNLNEELRDIPQAAKVNMTELDKEISTLRSGLKAVETEL    841 - 910
EYQKSQPPQPGDKFVSVVSQFITVASFSFSDVEDLLAEAKDLFTKAVKHFGEEAGKIQPDEFFGIFDQFL    911 - 980
QAVSEAKQENENMRKKKEEEERRARMEAQLKEQRERERKMRKAKENSEESGEFDDLVSALRSGEVFDKDL    981 - 1050
SKLKRNRKRITNQMTDSSRERPITKLNF                                             1051 - 1078
//

Text Mined References (31)

PMID Year Title
26644512 2015 The polarity protein Inturned links NPHP4 to Daam1 to control the subapical actin network in multiciliated cells.
25241761 2014 Using an in situ proximity ligation assay to systematically profile endogenous protein-protein interactions in a pathway network.
24696301 2014 Daam1 is a regulator of filopodia formation and phagocytic uptake of Borrelia burgdorferi by primary human macrophages.
24431302 2014 Wnt signaling in midbrain dopaminergic neuron development and regenerative medicine for Parkinson's disease.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22869791 2012 Systematic analysis of microRNA fingerprints in thrombocythemic platelets using integrated platforms.
22857009 2012 Deletion of a single-copy DAAM1 gene in congenital heart defect: a case report.
22655072 2012 Dvl2-dependent activation of Daam1 and RhoA regulates Wnt5a-induced breast cancer cell migration.
21269460 2011 Initial characterization of the human central proteome.
More...