Property Summary

NCBI Gene PubMed Count 22
PubMed Score 20.94
PubTator Score 18.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adult high grade glioma -1.100 2.0e-04
Chronic Lymphocytic Leukemia 1.422 1.0e-04
cystic fibrosis 1.574 9.8e-05
ependymoma -1.400 3.7e-07
group 3 medulloblastoma -1.900 1.2e-05
lung carcinoma 1.200 5.2e-07
malignant mesothelioma -1.600 2.4e-07
medulloblastoma, large-cell -2.900 3.7e-06
non primary Sjogren syndrome sicca 1.300 1.4e-02
non-small cell lung cancer 1.031 1.5e-05
osteosarcoma -1.408 5.7e-03
periodontitis 1.700 1.1e-32
ulcerative colitis 1.500 5.3e-04

Gene RIF (10)

AA Sequence

MSRSPQRALPPGALPRLLQAAPAAAPRALLPQWPRRPGRRWPASPLGMKVFRRKALVLCAGYALLLVLTM      1 - 70
LNLLDYKWHKEPLQQCNPDGPLGAAAGAAGGSWGRPGPPPAGPPRAHARLDLRTPYRPPAAAVGAAPAAA     71 - 140
AGMAGVAAPPGNGTRGTGGVGDKRQLVYVFTTWRSGSSFFGELFNQNPEVFFLYEPVWHVWQKLYPGDAV    141 - 210
SLQGAARDMLSALYRCDLSVFQLYSPAGSGGRNLTTLGIFGAATNKVVCSSPLCPAYRKEVVGLVDDRVC    211 - 280
KKCPPQRLARFEEECRKYRTLVIKGVRVFDVAVLAPLLRDPALDLKVIHLVRDPRAVASSRIRSRHGLIR    281 - 350
ESLQVVRSRDPRAHRMPFLEAAGHKLGAKKEGVGGPADYHALGAMEVICNSMAKTLQTALQPPDWLQGHY    351 - 420
LVVRYEDLVGDPVKTLRRVYDFVGLLVSPEMEQFALNMTSGSGSSSKPFVVSARNATQAANAWRTALTFQ    421 - 490
QIKQVEEFCYQPMAVLGYERVNSPEEVKDLSKTLLRKPRL                                  491 - 530
//

Text Mined References (23)

PMID Year Title