Property Summary

NCBI Gene PubMed Count 22
PubMed Score 20.71
PubTator Score 18.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
IGA Glomerulonephritis 454
Disease Target Count P-value
periodontitis 269 1.127276922233E-32
osteosarcoma 7933 6.62026947550588E-11
posterior fossa group B ependymoma 1530 1.22568512677829E-7
group 4 medulloblastoma 1875 2.39664878798083E-7
malignant mesothelioma 3163 2.44607652017948E-7
lung carcinoma 2844 5.21151688150573E-7
medulloblastoma, large-cell 6234 3.70650815203038E-6
non-small cell lung cancer 2798 1.48045856962435E-5
cystic fibrosis 1670 9.78174361879631E-5
chronic lymphocytic leukemia 244 1.02146446711053E-4
adult high grade glioma 2148 2.0282764717535E-4
ulcerative colitis 2087 5.31078325057714E-4
non primary Sjogren syndrome sicca 840 0.0137181431059454
Disease Target Count Z-score Confidence
Liver neoplasm 7 3.228 1.6

Expression

  Differential Expression (13)

Disease log2 FC p
chronic lymphocytic leukemia 1.422 0.000
malignant mesothelioma -1.600 0.000
osteosarcoma -2.763 0.000
posterior fossa group B ependymoma -1.600 0.000
group 4 medulloblastoma -2.400 0.000
cystic fibrosis 1.574 0.000
periodontitis 1.700 0.000
medulloblastoma, large-cell -2.900 0.000
non-small cell lung cancer 1.031 0.000
adult high grade glioma -1.100 0.000
non primary Sjogren syndrome sicca 1.300 0.014
lung carcinoma 1.200 0.000
ulcerative colitis 1.500 0.001

Synonym

Accession Q9Y4C5 D3DNG5 Q2M370 Q9GZN5 Q9UED5 Q9Y6F2
Symbols C6ST
GST2
GST-2
Gn6ST-1
HEL-S-75
glcNAc6ST-1

Gene

  Ortholog (7)

Gene RIF (10)

PMID Text
24799377 A method for O-GlcNAc detection using in vitro sulfation with two N-acetylglucosamine (GlcNAc)-specific sulfotransferases, carbohydrate sulfotransferase 2 and carbohydrate sulfotransferase 4.
21041608 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20677014 Observational study of gene-disease association. (HuGE Navigator)
19898482 Observational study of gene-disease association. (HuGE Navigator)
19571171 report the sites at which N-Acetylglucosamine-6-sulfotransferase-1 is modified with N-linked glycans and the effects that each glycan has on enzyme activity, specificity, and localization.[N-Acetylglucosamine-6-sulfotransferase-1]
19343046 Observational study of gene-disease association. (HuGE Navigator)
16897186 A novel tumor antigen that is specifically expressed in ovarian mucinous, clear cell and papillary serous adenocarcinomas.
12855678 is distributed throughout the Golgi apparatus and orchestrates the biosynthesis of L-selectin ligands
8419650 Sulfate is linked to the carbohydrate chains of HIV-1 glycoproteins gp160, gp120, and gp41 during the endoplasmic reticulum to Golgi transport of the glycoproteins
1433500 Sulfate is linked to the carbohydrate chains of HIV-1 glycoproteins gp160, gp120, and gp41 during the endoplasmic reticulum to Golgi transport of the glycoproteins

AA Sequence

MSRSPQRALPPGALPRLLQAAPAAAPRALLPQWPRRPGRRWPASPLGMKVFRRKALVLCAGYALLLVLTM      1 - 70
LNLLDYKWHKEPLQQCNPDGPLGAAAGAAGGSWGRPGPPPAGPPRAHARLDLRTPYRPPAAAVGAAPAAA     71 - 140
AGMAGVAAPPGNGTRGTGGVGDKRQLVYVFTTWRSGSSFFGELFNQNPEVFFLYEPVWHVWQKLYPGDAV    141 - 210
SLQGAARDMLSALYRCDLSVFQLYSPAGSGGRNLTTLGIFGAATNKVVCSSPLCPAYRKEVVGLVDDRVC    211 - 280
KKCPPQRLARFEEECRKYRTLVIKGVRVFDVAVLAPLLRDPALDLKVIHLVRDPRAVASSRIRSRHGLIR    281 - 350
ESLQVVRSRDPRAHRMPFLEAAGHKLGAKKEGVGGPADYHALGAMEVICNSMAKTLQTALQPPDWLQGHY    351 - 420
LVVRYEDLVGDPVKTLRRVYDFVGLLVSPEMEQFALNMTSGSGSSSKPFVVSARNATQAANAWRTALTFQ    421 - 490
QIKQVEEFCYQPMAVLGYERVNSPEEVKDLSKTLLRKPRL                                  491 - 530
//

Text Mined References (23)

PMID Year Title
24799377 2014 Detecting O-GlcNAc using in vitro sulfation.
22260995 2012 Expression of long-form N-acetylglucosamine-6-O-sulfotransferase 1 in human high endothelial venules.
21041608 2011 Family-based analysis of genetic variation underlying psychosis-inducing effects of cannabis: sibling analysis and proband follow-up.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
19898482 2009 Genetic variants in TPMT and COMT are associated with hearing loss in children receiving cisplatin chemotherapy.
19571171 2009 Effects of N-glycosylation on the activity and localization of GlcNAc-6-sulfotransferase 1.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
16897186 2006 Ectopic expression of N-acetylglucosamine 6-O-sulfotransferase 2 in chemotherapy-resistant ovarian adenocarcinomas.
15632306 2004 Role of the carboxyl-terminal region in the activity of N-acetylglucosamine 6-o-sulfotransferase-1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...