Property Summary

NCBI Gene PubMed Count 22
Grant Count 4
Funding $219,168
PubMed Score 20.71
PubTator Score 18.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
Chronic Lymphocytic Leukemia 1.422 0.000
malignant mesothelioma -1.600 0.000
osteosarcoma -2.763 0.000
posterior fossa group B ependymoma -1.600 0.000
group 4 medulloblastoma -2.400 0.000
cystic fibrosis 1.574 0.000
periodontitis 1.700 0.000
medulloblastoma, large-cell -2.900 0.000
non-small cell lung cancer 1.031 0.000
adult high grade glioma -1.100 0.000
non primary Sjogren syndrome sicca 1.300 0.014
lung carcinoma 1.200 0.000
ulcerative colitis 1.500 0.001

Synonym

Accession Q9Y4C5 D3DNG5 Q2M370 Q9GZN5 Q9UED5 Q9Y6F2
Symbols C6ST
GST2
GST-2
Gn6ST-1
HEL-S-75
glcNAc6ST-1

Gene

Gene RIF (10)

PMID Text
24799377 A method for O-GlcNAc detection using in vitro sulfation with two N-acetylglucosamine (GlcNAc)-specific sulfotransferases, carbohydrate sulfotransferase 2 and carbohydrate sulfotransferase 4.
21041608 Observational study of gene-disease association and gene-environment interaction. (HuGE Navigator)
20677014 Observational study of gene-disease association. (HuGE Navigator)
19898482 Observational study of gene-disease association. (HuGE Navigator)
19571171 report the sites at which N-Acetylglucosamine-6-sulfotransferase-1 is modified with N-linked glycans and the effects that each glycan has on enzyme activity, specificity, and localization.[N-Acetylglucosamine-6-sulfotransferase-1]
19343046 Observational study of gene-disease association. (HuGE Navigator)
16897186 A novel tumor antigen that is specifically expressed in ovarian mucinous, clear cell and papillary serous adenocarcinomas.
12855678 is distributed throughout the Golgi apparatus and orchestrates the biosynthesis of L-selectin ligands
8419650 Sulfate is linked to the carbohydrate chains of HIV-1 glycoproteins gp160, gp120, and gp41 during the endoplasmic reticulum to Golgi transport of the glycoproteins
1433500 Sulfate is linked to the carbohydrate chains of HIV-1 glycoproteins gp160, gp120, and gp41 during the endoplasmic reticulum to Golgi transport of the glycoproteins

AA Sequence

MSRSPQRALPPGALPRLLQAAPAAAPRALLPQWPRRPGRRWPASPLGMKVFRRKALVLCAGYALLLVLTM      1 - 70
LNLLDYKWHKEPLQQCNPDGPLGAAAGAAGGSWGRPGPPPAGPPRAHARLDLRTPYRPPAAAVGAAPAAA     71 - 140
AGMAGVAAPPGNGTRGTGGVGDKRQLVYVFTTWRSGSSFFGELFNQNPEVFFLYEPVWHVWQKLYPGDAV    141 - 210
SLQGAARDMLSALYRCDLSVFQLYSPAGSGGRNLTTLGIFGAATNKVVCSSPLCPAYRKEVVGLVDDRVC    211 - 280
KKCPPQRLARFEEECRKYRTLVIKGVRVFDVAVLAPLLRDPALDLKVIHLVRDPRAVASSRIRSRHGLIR    281 - 350
ESLQVVRSRDPRAHRMPFLEAAGHKLGAKKEGVGGPADYHALGAMEVICNSMAKTLQTALQPPDWLQGHY    351 - 420
LVVRYEDLVGDPVKTLRRVYDFVGLLVSPEMEQFALNMTSGSGSSSKPFVVSARNATQAANAWRTALTFQ    421 - 490
QIKQVEEFCYQPMAVLGYERVNSPEEVKDLSKTLLRKPRL                                  491 - 530
//

Text Mined References (23)

PMID Year Title
24799377 2014 Detecting O-GlcNAc using in vitro sulfation.
22260995 2012 Expression of long-form N-acetylglucosamine-6-O-sulfotransferase 1 in human high endothelial venules.
21041608 2011 Family-based analysis of genetic variation underlying psychosis-inducing effects of cannabis: sibling analysis and proband follow-up.
20677014 2010 An approach based on a genome-wide association study reveals candidate loci for narcolepsy.
19898482 2009 Genetic variants in TPMT and COMT are associated with hearing loss in children receiving cisplatin chemotherapy.
19571171 2009 Effects of N-glycosylation on the activity and localization of GlcNAc-6-sulfotransferase 1.
19343046 2009 Association study between single-nucleotide polymorphisms in 199 drug-related genes and commonly measured quantitative traits of 752 healthy Japanese subjects.
16897186 2006 Ectopic expression of N-acetylglucosamine 6-O-sulfotransferase 2 in chemotherapy-resistant ovarian adenocarcinomas.
15632306 2004 Role of the carboxyl-terminal region in the activity of N-acetylglucosamine 6-o-sulfotransferase-1.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...