Property Summary

NCBI Gene PubMed Count 11
PubMed Score 0.61
PubTator Score 0.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (15)

Disease log2 FC p
acute myeloid leukemia -1.200 3.7e-02
aldosterone-producing adenoma -1.687 1.6e-02
cystic fibrosis -1.543 4.5e-06
diabetes mellitus -1.500 1.5e-03
group 4 medulloblastoma 1.300 5.4e-05
head and neck cancer -1.200 2.3e-02
intraductal papillary-mucinous adenoma (... 1.400 2.5e-02
intraductal papillary-mucinous carcinoma... 1.600 3.3e-02
juvenile dermatomyositis 1.062 3.9e-06
lung adenocarcinoma 1.229 2.3e-05
malignant mesothelioma -1.100 1.1e-05
osteosarcoma 1.029 1.0e-03
ovarian cancer -1.500 8.4e-05
pancreatic ductal adenocarcinoma liver m... 1.190 1.9e-02
psoriasis -1.400 2.0e-05

Synonym

Accession Q9Y4C2 A8K6E0 Q75KM8 Q75KM9 Q7L665 Q9BW63
Symbols FAM115A

Gene

PANTHER Protein Class (3)

  Ortholog (1)

Species Source Disease
Chimp OMA EggNOG

Gene RIF (2)

AA Sequence

MATPSAAFEALMNGVTSWDVPEDAVPCELLLIGEASFPVMVNDMGQVLIAASSYGRGRLVVVSHEDYLVE      1 - 70
AQLTPFLLNAVGWLCSSPGAPIGVHPSLAPLAKILEGSGVDAKVEPEVKDSLGVYCIDAYNETMTEKLVK     71 - 140
FMKCGGGLLIGGQAWDWANQGEDERVLFTFPGNLVTSVAGIYFTDNKGDTSFFKVSKKMPKIPVLVSCED    141 - 210
DLSDDREELLHGISELDISNSDCFPSQLLVHGALAFPLGLDSYHGCVIAAARYGRGRVVVTGHKVLFTVG    211 - 280
KLGPFLLNAVRWLDGGRRGKVVVQTELRTLSGLLAVGGIDTSIEPNLTSDASVYCFEPVSEVGVKELQEF    281 - 350
VAEGGGLFVGAQAWWWAFKNPGVSPLARFPGNLLLNPFGISITSQSLNPGPFRTPKAGIRTYHFRSTLAE    351 - 420
FQVIMGRKRGNVEKGWLAKLGPDGAAFLQIPAEEIPAYMSVHRLLRKLLSRYRLPVATRENPVINDCCRG    421 - 490
AMLSLATGLAHSGSDLSLLVPEIEDMYSSPYLRPSESPITVEVNCTNPGTRYCWMSTGLYIPGRQIIEVS    491 - 560
LPEAAASADLKIQIGCHTDDLTRASKLFRGPLVINRCCLDKPTKSITCLWGGLLYIIVPQNSKLGSVPVT    561 - 630
VKGAVHAPYYKLGETTLEEWKRRIQENPGPWGELATDNIILTVPTANLRTLENPEPLLRLWDEVMQAVAR    631 - 700
LGAEPFPLRLPQRIVADVQISVGWMHAGYPIMCHLESVQELINEKLIRTKGLWGPVHELGRNQQRQEWEF    701 - 770
PPHTTEATCNLWCVYVHETVLGIPRSRANIALWPPVREKRVRIYLSKGPNVKNWNAWTALETYLQLQEAF    771 - 840
GWEPFIRLFTEYRNQTNLPTENVDKMNLWVKMFSHQVQKNLAPFFEAWAWPIQKEVATSLAYLPEWKENI    841 - 910
MKLYLLTQMPH                                                               911 - 921
//

Text Mined References (15)

PMID Year Title