Property Summary

Ligand Count 3
NCBI Gene PubMed Count 51
PubMed Score 74.69
PubTator Score 45.48

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
astrocytoma 1146 3.4e-20
oligodendroglioma 2850 9.3e-16
ovarian cancer 8520 5.7e-05
dermatomyositis 966 1.6e-03
Multiple myeloma 1332 1.2e-02
glioblastoma 5792 1.5e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.1
Liver cancer 604 0.0 0.6
Disease Target Count Z-score Confidence
Cancer 2499 3.246 1.6
Male infertility 206 3.205 1.6

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytoma 1.100 3.4e-20
dermatomyositis 1.100 1.6e-03
glioblastoma 1.200 1.5e-02
Multiple myeloma 1.472 1.2e-02
oligodendroglioma 1.200 9.3e-16
ovarian cancer -1.400 5.7e-05

Gene RIF (41)

AA Sequence

MVLTLGESWPVLVGRRFLSLSAADGSDGSHDSWDVERVAEWPWLSGTIRAVSHTDVTKKDLKVCVEFDGE      1 - 70
SWRKRRWIEVYSLLRRAFLVEHNLVLAERKSPEISERIVQWPAITYKPLLDKAGLGSITSVRFLGDQQRV     71 - 140
FLSKDLLKPIQDVNSLRLSLTDNQIVSKEFQALIVKHLDESHLLKGDKNLVGSEVKIYSLDPSTQWFSAT    141 - 210
VINGNPASKTLQVNCEEIPALKIVDPSLIHVEVVHDNLVTCGNSARIGAVKRKSSENNGTLVSKQAKSCS    211 - 280
EASPSMCPVQSVPTTVFKEILLGCTAATPPSKDPRQQSTPQAANSPPNLGAKIPQGCHKQSLPEEISSCL    281 - 350
NTKSEALRTKPDVCKAGLLSKSSQIGTGDLKILTEPKGSCTQPKTNTDQENRLESVPQALTGLPKECLPT    351 - 420
KASSKAELEIANPPELQKHLEHAPSPSDVSNAPEVKAGVNSDSPNNCSGKKVEPSALACRSQNLKESSVK    421 - 490
VDNESCCSRSNNKIQNAPSRKSVLTDPAKLKKLQQSGEAFVQDDSCVNIVAQLPKCRECRLDSLRKDKEQ    491 - 560
QKDSPVFCRFFHFRRLQFNKHGVLRVEGFLTPNKYDNEAIGLWLPLTKNVVGIDLDTAKYILANIGDHFC    561 - 630
QMVISEKEAMSTIEPHRQVAWKRAVKGVREMCDVCDTTIFNLHWVCPRCGFGVCVDCYRMKRKNCQQGAA    631 - 700
YKTFSWLKCVKSQIHEPENLMPTQIIPGKALYDVGDIVHSVRAKWGIKANCPCSNRQFKLFSKPASKEDL    701 - 770
KQTSLAGEKPTLGAVLQQNPSVLEPAAVGGEAASKPAGSMKPACPASTSPLNWLADLTSGNVNKENKEKQ    771 - 840
PTMPILKNEIKCLPPLPPLSKSSTVLHTFNSTILTPVSNNNSGFLRNLLNSSTGKTENGLKNTPKILDDI    841 - 910
FASLVQNKTTSDLSKRPQGLTIKPSILGFDTPHYWLCDNRLLCLQDPNNKSNWNVFRECWKQGQPVMVSG    911 - 980
VHHKLNSELWKPESFRKEFGEQEVDLVNCRTNEIITGATVGDFWDGFEDVPNRLKNEKEPMVLKLKDWPP    981 - 1050
GEDFRDMMPSRFDDLMANIPLPEYTRRDGKLNLASRLPNYFVRPDLGPKMYNAYGLITPEDRKYGTTNLH   1051 - 1120
LDVSDAANVMVYVGIPKGQCEQEEEVLKTIQDGDSDELTIKRFIEGKEKPGALWHIYAAKDTEKIREFLK   1121 - 1190
KVSEEQGQENPADHDPIHDQSWYLDRSLRKRLHQEYGVQGWAIVQFLGDVVFIPAGAPHQVHNLYSCIKV   1191 - 1260
AEDFVSPEHVKHCFWLTQEFRYLSQTHTNHEDKLQVKNVIYHAVKDAVAMLKASESSFGKP            1261 - 1321
//

Text Mined References (58)

PMID Year Title