Property Summary

NCBI Gene PubMed Count 39
Grant Count 26
R01 Count 18
Funding $1,864,405.32
PubMed Score 63.50
PubTator Score 45.48

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
Multiple myeloma 1.472 0.012
astrocytoma 1.600 0.005
glioblastoma 1.200 0.015
oligodendroglioma 1.200 0.000
ovarian cancer 2.200 0.000
dermatomyositis 1.100 0.002

Gene RIF (30)

PMID Text
26728187 These results indicate that the KDM3A-KLF2-IRF4 pathway plays an essential role in multiple myeloma cell survival and homing to the bone marrow, and therefore represents a therapeutic target.
26617828 JMJD1A-MALAT1-MAPK signaling might participate in the JMJD1A-induced cell proliferation of gastric cancer.
25948511 JMJD1A is phosphorylated at S265 by protein kinase A (PKA), and this is pivotal to activate the beta1-adrenergic receptor gene (Adrb1) and downstream targets including Ucp1 in brown adipocytes.
25609425 Loss of JMJD1A expression is associated with liver fibrosis.
25535969 mitogen- and stress-activated protein kinase 1 (MSK1) specifically phosphorylates KDM3A at Ser264 (p-KDM3A), which is enriched in the regulatory regions of gene loci in the human genome.
25148682 ACK1 interacts with KDM3A to regulate the mammary tumor oncogene HOXA1.
25071150 Studies found that JMJD1A was consistently and significantly downregulated at both RNA and protein levels in human germ cell tumors.
24742640 data identify a novel pathway through which N-Myc causes neuroblastoma cell migration and invasion, and provide important evidence for further development of more potent JMJD1A/MALAT1 inhibitors for the prevention of tumor metastasis.
24362521 Studies identify the histone demethylase KDM3A as a new, miR-regulated, tumor promoter in Ewing Sarcoma.
24214985 JMJD1A forms a homodimer through its catalytic domains, bringing the two active sites close together
More...

AA Sequence

MVLTLGESWPVLVGRRFLSLSAADGSDGSHDSWDVERVAEWPWLSGTIRAVSHTDVTKKDLKVCVEFDGE      1 - 70
SWRKRRWIEVYSLLRRAFLVEHNLVLAERKSPEISERIVQWPAITYKPLLDKAGLGSITSVRFLGDQQRV     71 - 140
FLSKDLLKPIQDVNSLRLSLTDNQIVSKEFQALIVKHLDESHLLKGDKNLVGSEVKIYSLDPSTQWFSAT    141 - 210
VINGNPASKTLQVNCEEIPALKIVDPSLIHVEVVHDNLVTCGNSARIGAVKRKSSENNGTLVSKQAKSCS    211 - 280
EASPSMCPVQSVPTTVFKEILLGCTAATPPSKDPRQQSTPQAANSPPNLGAKIPQGCHKQSLPEEISSCL    281 - 350
NTKSEALRTKPDVCKAGLLSKSSQIGTGDLKILTEPKGSCTQPKTNTDQENRLESVPQALTGLPKECLPT    351 - 420
KASSKAELEIANPPELQKHLEHAPSPSDVSNAPEVKAGVNSDSPNNCSGKKVEPSALACRSQNLKESSVK    421 - 490
VDNESCCSRSNNKIQNAPSRKSVLTDPAKLKKLQQSGEAFVQDDSCVNIVAQLPKCRECRLDSLRKDKEQ    491 - 560
QKDSPVFCRFFHFRRLQFNKHGVLRVEGFLTPNKYDNEAIGLWLPLTKNVVGIDLDTAKYILANIGDHFC    561 - 630
QMVISEKEAMSTIEPHRQVAWKRAVKGVREMCDVCDTTIFNLHWVCPRCGFGVCVDCYRMKRKNCQQGAA    631 - 700
YKTFSWLKCVKSQIHEPENLMPTQIIPGKALYDVGDIVHSVRAKWGIKANCPCSNRQFKLFSKPASKEDL    701 - 770
KQTSLAGEKPTLGAVLQQNPSVLEPAAVGGEAASKPAGSMKPACPASTSPLNWLADLTSGNVNKENKEKQ    771 - 840
PTMPILKNEIKCLPPLPPLSKSSTVLHTFNSTILTPVSNNNSGFLRNLLNSSTGKTENGLKNTPKILDDI    841 - 910
FASLVQNKTTSDLSKRPQGLTIKPSILGFDTPHYWLCDNRLLCLQDPNNKSNWNVFRECWKQGQPVMVSG    911 - 980
VHHKLNSELWKPESFRKEFGEQEVDLVNCRTNEIITGATVGDFWDGFEDVPNRLKNEKEPMVLKLKDWPP    981 - 1050
GEDFRDMMPSRFDDLMANIPLPEYTRRDGKLNLASRLPNYFVRPDLGPKMYNAYGLITPEDRKYGTTNLH   1051 - 1120
LDVSDAANVMVYVGIPKGQCEQEEEVLKTIQDGDSDELTIKRFIEGKEKPGALWHIYAAKDTEKIREFLK   1121 - 1190
KVSEEQGQENPADHDPIHDQSWYLDRSLRKRLHQEYGVQGWAIVQFLGDVVFIPAGAPHQVHNLYSCIKV   1191 - 1260
AEDFVSPEHVKHCFWLTQEFRYLSQTHTNHEDKLQVKNVIYHAVKDAVAMLKASESSFGKP            1261 - 1321
//

Text Mined References (46)

PMID Year Title
26728187 2016 The KDM3A-KLF2-IRF4 axis maintains myeloma cell survival.
26617828 2015 Elevated JMJD1A is a novel predictor for prognosis and a potential therapeutic target for gastric cancer.
25948511 2015 JMJD1A is a signal-sensing scaffold that regulates acute chromatin dynamics via SWI/SNF association for thermogenesis.
25609425 2015 Histone H3K9 demethylase JMJD1A modulates hepatic stellate cells activation and liver fibrosis by epigenetically regulating peroxisome proliferator-activated receptor ?.
25535969 2014 Specific phosphorylation of histone demethylase KDM3A determines target gene expression in response to heat shock.
25148682 2014 ACK1 tyrosine kinase interacts with histone demethylase KDM3A to regulate the mammary tumor oncogene HOXA1.
25071150 2014 The hypoxia-inducible epigenetic regulators Jmjd1a and G9a provide a mechanistic link between angiogenesis and tumor growth.
24742640 2014 The histone demethylase JMJD1A induces cell migration and invasion by up-regulating the expression of the long noncoding RNA MALAT1.
24362521 2015 The histone demethylase KDM3A is a microRNA-22-regulated tumor promoter in Ewing Sarcoma.
24214985 2013 Control of histone H3 lysine 9 (H3K9) methylation state via cooperative two-step demethylation by Jumonji domain containing 1A (JMJD1A) homodimer.
More...