Property Summary

NCBI Gene PubMed Count 55
PubMed Score 34.81
PubTator Score 15.08

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Substance-Related Disorders 115 0.0 0.0
Disease Target Count Z-score Confidence
Autistic Disorder 364 4.018 2.0
Nicotine dependence 54 3.448 1.7

Expression

  Differential Expression (26)

Disease log2 FC p
adult high grade glioma -3.900 7.3e-09
astrocytic glioma -1.600 1.7e-02
Astrocytoma, Pilocytic -2.000 9.3e-06
atypical teratoid / rhabdoid tumor -4.100 1.1e-09
Breast cancer 1.300 4.7e-02
colon cancer -1.600 2.4e-03
cystic fibrosis -1.224 1.3e-05
Endometriosis -1.034 3.8e-02
ependymoma -2.400 1.2e-02
glioblastoma -3.600 1.0e-11
group 3 medulloblastoma -3.600 4.7e-06
interstitial cystitis 1.100 4.9e-02
intraductal papillary-mucinous adenoma (... -1.400 1.5e-02
intraductal papillary-mucinous carcinoma... -1.900 7.6e-04
intraductal papillary-mucinous neoplasm ... -2.100 3.0e-03
lung adenocarcinoma -1.100 2.0e-08
lung cancer 2.000 1.4e-04
malignant mesothelioma -3.400 5.3e-09
medulloblastoma, large-cell -4.700 3.4e-07
oligodendroglioma -1.100 1.9e-02
osteosarcoma -1.916 2.1e-03
ovarian cancer -2.300 7.1e-09
Pick disease -1.900 2.8e-02
primitive neuroectodermal tumor -2.300 1.9e-02
psoriasis -1.400 6.7e-74
subependymal giant cell astrocytoma -1.742 2.6e-02

Gene RIF (33)

AA Sequence

MSSTLHSVFFTLKVSILLGSLLGLCLGLEFMGLPNQWARYLRWDASTRSDLSFQFKTNVSTGLLLYLDDG      1 - 70
GVCDFLCLSLVDGRVQLRFSMDCAETAVLSNKQVNDSSWHFLMVSRDRLRTVLMLDGEGQSGELQPQRPY     71 - 140
MDVVSDLFLGGVPTDIRPSALTLDGVQAMPGFKGLILDLKYGNSEPRLLGSRGVQMDAEGPCGERPCENG    141 - 210
GICFLLDGHPTCDCSTTGYGGKLCSEDVSQDPGLSHLMMSEQAREENVATFRGSEYLCYDLSQNPIQSSS    211 - 280
DEITLSFKTWQRNGLILHTGKSADYVNLALKDGAVSLVINLGSGAFEAIVEPVNGKFNDNAWHDVKVTRN    281 - 350
LRQVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKEVVYKNNDIRLELS    351 - 420
RLARIADTKMKIYGEVVFKCENVATLDPINFETPEAYISLPKWNTKRMGSISFDFRTTEPNGLILFTHGK    421 - 490
PQERKDARSQKNTKVDFFAVELLDGNLYLLLDMGSGTIKVKATQKKANDGEWYHVDIQRDGRSGTISVNS    491 - 560
RRTPFTASGESEILDLEGDMYLGGLPENRAGLILPTELWTAMLNYGYVGCIRDLFIDGRSKNIRQLAEMQ    561 - 630
NAAGVKSSCSRMSAKQCDSYPCKNNAVCKDGWNRFICDCTGTGYWGRTCEREASILSYDGSMYMKIIMPM    631 - 700
VMHTEAEDVSFRFMSQRAYGLLVATTSRDSADTLRLELDGGRVKLMVNLDCIRINCNSSKGPETLYAGQK    701 - 770
LNDNEWHTVRVVRRGKSLKLTVDDDVAEGTMVGDHTRLEFHNIETGIMTEKRYISVVPSSFIGHLQSLMF    771 - 840
NGLLYIDLCKNGDIDYCELKARFGLRNIIADPVTFKTKSSYLSLATLQAYTSMHLFFQFKTTSPDGFILF    841 - 910
NSGDGNDFIAVELVKGYIHYVFDLGNGPNVIKGNSDRPLNDNQWHNVVITRDNSNTHSLKVDTKVVTQVI    911 - 980
NGAKNLDLKGDLYMAGLAQGMYSNLPKLVASRDGFQGCLASVDLNGRLPDLINDALHRSGQIERGCEGPS    981 - 1050
TTCQEDSCANQGVCMQQWEGFTCDCSMTSYSGNQCNDPGATYIFGKSGGLILYTWPANDRPSTRSDRLAV   1051 - 1120
GFSTTVKDGILVRIDSAPGLGDFLQLHIEQGKIGVVFNIGTVDISIKEERTPVNDGKYHVVRFTRNGGNA   1121 - 1190
TLQVDNWPVNEHYPTGRQLTIFNTQAQIAIGGKDKGRLFQGQLSGLYYDGLKVLNMAAENNPNIKINGSV   1191 - 1260
RLVGEVPSILGTTQTTSMPPEMSTTVMETTTTMATTTTRKNRSTASIQPTSDDLVSSAECSSDDEDFVEC   1261 - 1330
EPSTTGGELVIPLLVEDPLATPPIATRAPSITLPPTFRPLLTIIETTKDSLSMTSEAGLPCLSDQGSDGC   1331 - 1400
DDDGLVISGYGSGETFDSNLPPTDDEDFYTTFSLVTDKSLSTSIFEGGYKAHAPKWESKDFRPNKVSETS   1401 - 1470
RTTTTSLSPELIRFTASSSSGMVPKLPAGKMNNRDLKPQPDIVLLPLPTAYELDSTKLKSPLITSPMFRN   1471 - 1540
VPTANPTEPGIRRVPGASEVIRESSSTTGMVVGIVAAAALCILILLYAMYKYRNRDEGSYQVDETRNYIS   1541 - 1610
NSAQSNGTLMKEKQQSSKSGHKKQKNKDREYYV                                        1611 - 1643
//

Text Mined References (57)

PMID Year Title