Property Summary

NCBI Gene PubMed Count 54
PubMed Score 33.01
PubTator Score 15.08

Knowledge Summary

Patent

No data available

Gene RIF (31)

PMID Text
25450229 The rare variants in NRXN3 were significantly associated with smoking status.
24469609 This study confirmed the genetic heterogeneity of cluster headache, suggesting that a novel rearrangement involving NRXN3 gene might be related to cluster headache in a subset of cases
24444492 The study showed that markers rs2217887 (NRXN3) showed weak associations.
24265751 a positive association between Neurexin 3 and controls in the Han Chinese population, and genetic evidence to support the susceptibility of DEACMP
23909413 Neurexin 3-alpha (NRXN3) is a synaptic cell-cell adhesion molecule involved in maintenance of neural connections (such as the maintenance of smoking behavior).
23383267 FoxQ1 promotes glioma cell proliferation and migration by down-regulation of NRXN3 expression.
23306218 Our findings suggested that NRXN3 might represent a major susceptibility gene for schizophrenia
23245376 the study finds preliminary evidence for the association of NRXN3 with Borderline Personality Disorder phenotypes. The strongest association with positive screening for BPD was found for SNP rs10083466.
23118423 Association of the Graves disease phenotype with two markers, rs12147587 and rs2284720, located within the NRXN3 and TSHR genes, respectively.
22716474 NRXN3 polymorphisms play a role in susceptibility to smoking behavior and are strongly implicated in human genetic vulnerability to addictive behaviors.
More...

AA Sequence

MSSTLHSVFFTLKVSILLGSLLGLCLGLEFMGLPNQWARYLRWDASTRSDLSFQFKTNVSTGLLLYLDDG      1 - 70
GVCDFLCLSLVDGRVQLRFSMDCAETAVLSNKQVNDSSWHFLMVSRDRLRTVLMLDGEGQSGELQPQRPY     71 - 140
MDVVSDLFLGGVPTDIRPSALTLDGVQAMPGFKGLILDLKYGNSEPRLLGSRGVQMDAEGPCGERPCENG    141 - 210
GICFLLDGHPTCDCSTTGYGGKLCSEDVSQDPGLSHLMMSEQAREENVATFRGSEYLCYDLSQNPIQSSS    211 - 280
DEITLSFKTWQRNGLILHTGKSADYVNLALKDGAVSLVINLGSGAFEAIVEPVNGKFNDNAWHDVKVTRN    281 - 350
LRQVTISVDGILTTTGYTQEDYTMLGSDDFFYVGGSPSTADLPGSPVSNNFMGCLKEVVYKNNDIRLELS    351 - 420
RLARIADTKMKIYGEVVFKCENVATLDPINFETPEAYISLPKWNTKRMGSISFDFRTTEPNGLILFTHGK    421 - 490
PQERKDARSQKNTKVDFFAVELLDGNLYLLLDMGSGTIKVKATQKKANDGEWYHVDIQRDGRSGTISVNS    491 - 560
RRTPFTASGESEILDLEGDMYLGGLPENRAGLILPTELWTAMLNYGYVGCIRDLFIDGRSKNIRQLAEMQ    561 - 630
NAAGVKSSCSRMSAKQCDSYPCKNNAVCKDGWNRFICDCTGTGYWGRTCEREASILSYDGSMYMKIIMPM    631 - 700
VMHTEAEDVSFRFMSQRAYGLLVATTSRDSADTLRLELDGGRVKLMVNLDCIRINCNSSKGPETLYAGQK    701 - 770
LNDNEWHTVRVVRRGKSLKLTVDDDVAEGTMVGDHTRLEFHNIETGIMTEKRYISVVPSSFIGHLQSLMF    771 - 840
NGLLYIDLCKNGDIDYCELKARFGLRNIIADPVTFKTKSSYLSLATLQAYTSMHLFFQFKTTSPDGFILF    841 - 910
NSGDGNDFIAVELVKGYIHYVFDLGNGPNVIKGNSDRPLNDNQWHNVVITRDNSNTHSLKVDTKVVTQVI    911 - 980
NGAKNLDLKGDLYMAGLAQGMYSNLPKLVASRDGFQGCLASVDLNGRLPDLINDALHRSGQIERGCEGPS    981 - 1050
TTCQEDSCANQGVCMQQWEGFTCDCSMTSYSGNQCNDPGATYIFGKSGGLILYTWPANDRPSTRSDRLAV   1051 - 1120
GFSTTVKDGILVRIDSAPGLGDFLQLHIEQGKIGVVFNIGTVDISIKEERTPVNDGKYHVVRFTRNGGNA   1121 - 1190
TLQVDNWPVNEHYPTGRQLTIFNTQAQIAIGGKDKGRLFQGQLSGLYYDGLKVLNMAAENNPNIKINGSV   1191 - 1260
RLVGEVPSILGTTQTTSMPPEMSTTVMETTTTMATTTTRKNRSTASIQPTSDDLVSSAECSSDDEDFVEC   1261 - 1330
EPSTTGGELVIPLLVEDPLATPPIATRAPSITLPPTFRPLLTIIETTKDSLSMTSEAGLPCLSDQGSDGC   1331 - 1400
DDDGLVISGYGSGETFDSNLPPTDDEDFYTTFSLVTDKSLSTSIFEGGYKAHAPKWESKDFRPNKVSETS   1401 - 1470
RTTTTSLSPELIRFTASSSSGMVPKLPAGKMNNRDLKPQPDIVLLPLPTAYELDSTKLKSPLITSPMFRN   1471 - 1540
VPTANPTEPGIRRVPGASEVIRESSSTTGMVVGIVAAAALCILILLYAMYKYRNRDEGSYQVDETRNYIS   1541 - 1610
NSAQSNGTLMKEKQQSSKSGHKKQKNKDREYYV                                        1611 - 1643
//

Text Mined References (56)

PMID Year Title
25450229 2015 The contribution of rare and common variants in 30 genes to risk nicotine dependence.
25189868 2015 Gene-smoking interactions identify several novel blood pressure loci in the Framingham Heart Study.
25133637 2014 Genome-wide association studies and heritability estimates of body mass index related phenotypes in Bangladeshi adults.
24469609 2015 Molecular analysis of cluster headache.
24444492 2014 Identification of novel loci for bipolar I disorder in a multi-stage genome-wide association study.
24265751 2013 DNA pooling base genome-wide association study identifies variants at NRXN3 associated with delayed encephalopathy after acute carbon monoxide poisoning.
23909413 2013 Gene × smoking interactions on human brain gene expression: finding common mechanisms in adolescents and adults.
23563607 2013 Genome-wide meta-analysis identifies 11 new loci for anthropometric traits and provides insights into genetic architecture.
23383267 2013 FoxQ1 promotes glioma cells proliferation and migration by regulating NRXN3 expression.
23306218 2013 Association study of NRXN3 polymorphisms with schizophrenia and risperidone-induced bodyweight gain in Chinese Han population.
More...