Property Summary

NCBI Gene PubMed Count 42
Grant Count 36
R01 Count 29
Funding $5,274,503.98
PubMed Score 52.30
PubTator Score 54.51

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
hepatocellular carcinoma 1.100 0.001
cutaneous lupus erythematosus -1.300 0.001
psoriasis -1.600 0.000
osteosarcoma -2.806 0.000
tuberculosis and treatment for 6 months 1.500 0.000
group 3 medulloblastoma 1.600 0.000
Breast cancer -1.700 0.000
ovarian cancer 1.100 0.000

Gene RIF (152)

PMID Text
26186441 Env-dependent MDM/T cell viral synapse formation is facilitated by Vpr/VPRBP (DCAF1) cooperation
26186441 Env-dependent MDM/T cell viral synapse formation is facilitated by Vpr/VPRBP (DCAF1) cooperation
26186441 Env-dependent MDM/T cell viral synapse formation is facilitated by Vpr/VPRBP (DCAF1) cooperation
26186441 Env-dependent MDM/T cell viral synapse formation is facilitated by Vpr/VPRBP (DCAF1) cooperation
26032416 MCM10 is the natural substrate of the Cul4-DDB1[VprBP] E3 ubiquitin ligase whose degradation is regulated by VprBP, but Vpr enhances the proteasomal degradation of MCM10 by interacting with VprBP.
25807049 Env-dependent MDM/T cell viral synapse formation is facilitated by Vpr/VPRBP (DCAF1) cooperation
25618414 Env-dependent MDM/T cell viral synapse formation is facilitated by Vpr/VPRBP (DCAF1) cooperation
25557551 VprBP, but not DDB1, directly binds to TET2-catalytic domain.
25499532 Vpr and Vpx share a highly similar DCAF1-binding motif, they interact with a different set of residues in DCAF1.
25499532 Env-dependent MDM/T cell viral synapse formation is facilitated by Vpr/VPRBP (DCAF1) cooperation
More...

AA Sequence

MTTVVVHVDSKAELTTLLEQWEKEHGSGQDMVPILTRMSQLIEKETEEYRKGDPDPFDDRHPGRADPECM      1 - 70
LGHLLRILFKNDDFMNALVNAYVMTSREPPLNTAACRLLLDIMPGLETAVVFQEKEGIVENLFKWAREAD     71 - 140
QPLRTYSTGLLGGAMENQDIAANYRDENSQLVAIVLRRLRELQLQEVALRQENKRPSPRKLSSEPLLPLD    141 - 210
EEAVDMDYGDMAVDVVDGDQEEASGDMEISFHLDSGHKTSSRVNSTTKPEDGGLKKNKSAKQGDRENFRK    211 - 280
AKQKLGFSSSDPDRMFVELSNSSWSEMSPWVIGTNYTLYPMTPAIEQRLILQYLTPLGEYQELLPIFMQL    281 - 350
GSRELMMFYIDLKQTNDVLLTFEALKHLASLLLHNKFATEFVAHGGVQKLLEIPRPSMAATGVSMCLYYL    351 - 420
SYNQDAMERVCMHPHNVLSDVVNYTLWLMECSHASGCCHATMFFSICFSFRAVLELFDRYDGLRRLVNLI    421 - 490
STLEILNLEDQGALLSDDEIFASRQTGKHTCMALRKYFEAHLAIKLEQVKQSLQRTEGGILVHPQPPYKA    491 - 560
CSYTHEQIVEMMEFLIEYGPAQLYWEPAEVFLKLSCVQLLLQLISIACNWKTYYARNDTVRFALDVLAIL    561 - 630
TVVPKIQLQLAESVDVLDEAGSTVSTVGISIILGVAEGEFFIHDAEIQKSALQIIINCVCGPDNRISSIG    631 - 700
KFISGTPRRKLPQNPKSSEHTLAKMWNVVQSNNGIKVLLSLLSIKMPITDADQIRALACKALVGLSRSST    701 - 770
VRQIISKLPLFSSCQIQQLMKEPVLQDKRSDHVKFCKYAAELIERVSGKPLLIGTDVSLARLQKADVVAQ    771 - 840
SRISFPEKELLLLIRNHLISKGLGETATVLTKEADLPMTAASHSSAFTPVTAAASPVSLPRTPRIANGIA    841 - 910
TRLGSHAAVGASAPSAPTAHPQPRPPQGPLALPGPSYAGNSPLIGRISFIRERPSPCNGRKIRVLRQKSD    911 - 980
HGAYSQSPAIKKQLDRHLPSPPTLDSIITEYLREQHARCKNPVATCPPFSLFTPHQCPEPKQRRQAPINF    981 - 1050
TSRLNRRASFPKYGGVDGGCFDRHLIFSRFRPISVFREANEDESGFTCCAFSARERFLMLGTCTGQLKLY   1051 - 1120
NVFSGQEEASYNCHNSAITHLEPSRDGSLLLTSATWSQPLSALWGMKSVFDMKHSFTEDHYVEFSKHSQD   1121 - 1190
RVIGTKGDIAHIYDIQTGNKLLTLFNPDLANNYKRNCATFNPTDDLVLNDGVLWDVRSAQAIHKFDKFNM   1191 - 1260
NISGVFHPNGLEVIINTEIWDLRTFHLLHTVPALDQCRVVFNHTGTVMYGAMLQADDEDDLMEERMKSPF   1261 - 1330
GSSFRTFNATDYKPIATIDVKRNIFDLCTDTKDCYLAVIENQGSMDALNMDTVCRLYEVGRQRLAEDEDE   1331 - 1400
EEDQEEEEQEEEDDDEDDDDTDDLDELDTDQLLEAELEEDDNNENAGEDGDNDFSPSDEELANLLEEGED   1401 - 1470
GEDEDSDADEEVELILGDTDSSDNSDLEDDIILSLNE                                    1471 - 1507
//

Text Mined References (65)

PMID Year Title
26032416 2015 HIV-1 Vpr Protein Enhances Proteasomal Degradation of MCM10 DNA Replication Factor through the Cul4-DDB1[VprBP] E3 Ubiquitin Ligase to Induce G2/M Cell Cycle Arrest.
25557551 2015 CRL4(VprBP) E3 ligase promotes monoubiquitylation and chromatin binding of TET dioxygenases.
25499532 2015 Understanding the molecular manipulation of DCAF1 by the lentiviral accessory proteins Vpr and Vpx.
25200749 2015 The HIV-1 accessory protein Vpr induces the degradation of the anti-HIV-1 agent APOBEC3G through a VprBP-mediated proteasomal pathway.
25026211 2014 Merlin/NF2 loss-driven tumorigenesis linked to CRL4(DCAF1)-mediated inhibition of the hippo pathway kinases Lats1 and 2 in the nucleus.
24932481 2014 miRNA-1236 inhibits HIV-1 infection of monocytes by repressing translation of cellular factor VprBP.
24912982 2014 Interactions with DCAF1 and DDB1 in the CRL4 E3 ubiquitin ligase are required for Vpr-mediated G2 arrest.
24912773 2014 Structural basis of DDB1-and-Cullin 4-associated Factor 1 (DCAF1) recognition by merlin/NF2 and its implication in tumorigenesis by CD44-mediated inhibition of merlin suppression of DCAF1 function.
24706749 2014 Structural basis of the binding of Merlin FERM domain to the E3 ubiquitin ligase substrate adaptor DCAF1.
24558487 2014 Defining the interactions and role of DCAF1/VPRBP in the DDB1-cullin4A E3 ubiquitin ligase complex engaged by HIV-1 Vpr to induce a G2 cell cycle arrest.
More...