Property Summary

NCBI Gene PubMed Count 43
Grant Count 74
R01 Count 56
Funding $8,508,267.27
PubMed Score 107.38
PubTator Score 47.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
malignant mesothelioma -1.800 0.000
glioblastoma -2.600 0.000
osteosarcoma 1.272 0.000
ependymoma -1.600 0.000
medulloblastoma -2.000 0.000
atypical teratoid / rhabdoid tumor -2.300 0.000
medulloblastoma, large-cell -3.200 0.000
adrenocortical carcinoma 1.700 0.000
Parkinson's disease -1.200 0.012
pediatric high grade glioma -2.000 0.000
lung carcinoma 1.700 0.000
chronic rhinosinusitis -1.160 0.039
cystic fibrosis and chronic rhinosinusit... -1.353 0.025

Synonym

Accession Q9Y496 A8MSW9 Q59EN1 Q86XE9 Q9Y6V4
Symbols FLA10
KLP-20

Gene

Gene RIF (24)

PMID Text
26127003 KIF3A and OVOL1 are involved in the development of Atopic dermatitis in the Chinese pediatric population.
25878107 Ablation of this phosphorylation abolished herpes simplex virus 1 US3-mediated downregulation of CD1d expression, suggesting that phosphorylation of KIF3A is the primary mechanism of viral suppression of CD1d expression.
25588831 These data suggest that GLI interactions with KIF3A-KIF3B-KAP3 complexes are essential for proper GLI transcriptional activity.
24413182 Findings support the notion that upregulation of KIF3a is causal of aberrant activation of Wnt signaling in advanced prostate cancer through the KIF3a-DVL2-beta-catenin axis.
24338362 POPX2 affects trafficking by determining the phosphorylation status of KIF3A at serine 690.
23386061 in addition to its ciliogenic roles, Kif3a recruits p150(Glued) to the subdistal appendages of mother centrioles, critical for centrosomes to function as microtubule-organizing centres.
23278845 Association of KIF3A, but not OVOL1 and ACTL9, with atopic eczema in Italian patients
21912604 KIF3A is a novel candidate gene for childhood asthma
21841072 Changes of IP7 intracellular levels affect HIV-1 Gag release through modulation of AP3B1 and Kif3A interaction
20922562 Our findings suggest that the KIF3A gene and/or its polymorphisms might have a susceptibility effect on aspirin-intolerant asthma (AIA).
More...

AA Sequence

MPINKSEKPESCDNVKVVVRCRPLNEREKSMCYKQAVSVDEMRGTITVHKTDSSNEPPKTFTFDTVFGPE      1 - 70
SKQLDVYNLTARPIIDSVLEGYNGTIFAYGQTGTGKTFTMEGVRAIPELRGIIPNSFAHIFGHIAKAEGD     71 - 140
TRFLVRVSYLEIYNEEVRDLLGKDQTQRLEVKERPDVGVYIKDLSAYVVNNADDMDRIMTLGHKNRSVGA    141 - 210
TNMNEHSSRSHAIFTITIECSEKGIDGNMHVRMGKLHLVDLAGSERQAKTGATGQRLKEATKINLSLSTL    211 - 280
GNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTMMCANIGPADYNYDETISTLRYANRAKNIKNKAR    281 - 350
INEDPKDALLRQFQKEIEELKKKLEEGEEISGSDISGSEEDDDEEGEVGEDGEKRKKRRGKKKVSPDKMI    351 - 420
EMQAKIDEERKALETKLDMEEEERNKARAELEKREKDLLKAQQEHQSLLEKLSALEKKVIVGGVDLLAKA    421 - 490
EEQEKLLEESNMELEERRKRAEQLRRELEEKEQERLDIEEKYTSLQEEAQGKTKKLKKVWTMLMAAKSEM    491 - 560
ADLQQEHQREIEGLLENIRQLSRELRLQMLIIDNFIPRDYQEMIENYVHWNEDIGEWQLKCVAYTGNNMR    561 - 630
KQTPVPDKKEKDPFEVDLSHVYLAYTEESLRQSLMKLERPRTSKGKARPKTGRRKRSAKPETVIDSLLQ     631 - 699
//

Publication (46)

PMID Year Title
27173435 2016 An organelle-specific protein landscape identifies novel diseases and molecular mechanisms.
26496610 2015 A human interactome in three quantitative dimensions organized by stoichiometries and abundances.
26127003 2015 Correlation of KIF3A and OVOL1, but not ACTL9, with atopic dermatitis in Chinese pediatric patients.
26021297 2015 The small GTPase Rab29 is a common regulator of immune synapse assembly and ciliogenesis.
25878107 2015 Herpes Simplex Virus 1 US3 Phosphorylates Cellular KIF3A To Downregulate CD1d Expression.
25588831 2015 The heterotrimeric kinesin-2 complex interacts with and regulates GLI protein function.
24591568 2014 FIP5 phosphorylation during mitosis regulates apical trafficking and lumenogenesis.
24413182 2014 KIF3a promotes proliferation and invasion via Wnt signaling in advanced prostate cancer.
24338362 2014 POPX2 phosphatase regulates the KIF3 kinesin motor complex.
23704327 2013 The giant spectrin ?V couples the molecular motors to phototransduction and Usher syndrome type I proteins along their trafficking route.
More...