Property Summary

NCBI Gene PubMed Count 46
PubMed Score 113.61
PubTator Score 47.25

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
adrenocortical carcinoma 1.700 6.4e-06
adult high grade glioma -1.700 4.0e-03
atypical teratoid / rhabdoid tumor -2.300 3.8e-07
chronic rhinosinusitis -1.160 3.9e-02
cystic fibrosis and chronic rhinosinusit... -1.353 2.5e-02
ependymoma -1.600 2.8e-11
glioblastoma -1.400 1.7e-04
lung carcinoma 1.700 3.1e-21
malignant mesothelioma -1.800 3.2e-05
medulloblastoma -1.200 1.1e-03
medulloblastoma, large-cell -3.200 6.1e-06
osteosarcoma 1.272 8.6e-05
Parkinson's disease -1.200 1.2e-02

Gene RIF (26)

AA Sequence

MPINKSEKPESCDNVKVVVRCRPLNEREKSMCYKQAVSVDEMRGTITVHKTDSSNEPPKTFTFDTVFGPE      1 - 70
SKQLDVYNLTARPIIDSVLEGYNGTIFAYGQTGTGKTFTMEGVRAIPELRGIIPNSFAHIFGHIAKAEGD     71 - 140
TRFLVRVSYLEIYNEEVRDLLGKDQTQRLEVKERPDVGVYIKDLSAYVVNNADDMDRIMTLGHKNRSVGA    141 - 210
TNMNEHSSRSHAIFTITIECSEKGIDGNMHVRMGKLHLVDLAGSERQAKTGATGQRLKEATKINLSLSTL    211 - 280
GNVISALVDGKSTHVPYRNSKLTRLLQDSLGGNSKTMMCANIGPADYNYDETISTLRYANRAKNIKNKAR    281 - 350
INEDPKDALLRQFQKEIEELKKKLEEGEEISGSDISGSEEDDDEEGEVGEDGEKRKKRRGKKKVSPDKMI    351 - 420
EMQAKIDEERKALETKLDMEEEERNKARAELEKREKDLLKAQQEHQSLLEKLSALEKKVIVGGVDLLAKA    421 - 490
EEQEKLLEESNMELEERRKRAEQLRRELEEKEQERLDIEEKYTSLQEEAQGKTKKLKKVWTMLMAAKSEM    491 - 560
ADLQQEHQREIEGLLENIRQLSRELRLQMLIIDNFIPRDYQEMIENYVHWNEDIGEWQLKCVAYTGNNMR    561 - 630
KQTPVPDKKEKDPFEVDLSHVYLAYTEESLRQSLMKLERPRTSKGKARPKTGRRKRSAKPETVIDSLLQ     631 - 699
//

Text Mined References (49)

PMID Year Title