Property Summary

NCBI Gene PubMed Count 108
Grant Count 37
R01 Count 16
Funding $4,447,210.79
PubMed Score 80.35
PubTator Score 58.65

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
ependymoma 1.500 0.008
psoriasis -3.500 0.000
glioblastoma 2.500 0.000
osteosarcoma -3.765 0.000
astrocytoma 1.500 0.001
atypical teratoid / rhabdoid tumor 1.900 0.000
diabetes mellitus -1.100 0.003
pediatric high grade glioma 1.600 0.000
pilocytic astrocytoma 1.700 0.000
COPD -1.200 0.003
invasive ductal carcinoma -1.200 0.005
acute myeloid leukemia 1.100 0.003

 GWAS Trait (1)

Gene RIF (60)

PMID Text
26822056 Both TLN-1 and TLN-2 levels correlate with tumorigenicity in human HCC, indicating that these molecules constitute important molecular targets for the diagnosis and/or treatment of hepatocellular carcinoma .
26419705 Disruption of the RIAM/lamellipodin-integrin-talin complex markedly impairs cell migration.
26336988 TLN1 significantly increases in refractory glioblastoma multiforme
26283369 results identify talin as the primary determinant of FA nanoscale organization and suggest how multiple cellular forces may be integrated at adhesion sites
26000342 Applying correlative imaging to link live cell and fixed immunofluorescence data on a single cell basis, we related per cell talin-1 levels to per cell measures quantitatively defining an array of cellular properties.
25925041 Our data demonstrate that high expression of Talin-1 is associated with significantly poorer OS and poorer DMFS in NPC and depletion of Talin-1 expression inhibited NPC cell migration and invasion. Talin-1 may serve as novel prognostic biomarker in NPC.
25233425 Data suggest that anionic lipids (such as phosphatidylinositol phosphates) play crucial role in localization of peripheral membrane proteins (such as TLN1, auxilin-1, and PTEN [phosphatase and tensin homolog]). [review-like article]
25142525 Talin extension is a key step in sensing and responding to substrate stiffness at cell adhesion sites.
24891603 Talin has a role in regulating moesin-NHE-1 recruitment to invadopodia in breast cancer
24793790 phosphorylation of talin1 leading to beta1 integrin activation is a novel mechanism that increases metastatic potential of prostate cancer cells.
More...

AA Sequence

MVALSLKISIGNVVKTMQFEPSTMVYDACRIIRERIPEAPAGPPSDFGLFLSDDDPKKGIWLEAGKALDY      1 - 70
YMLRNGDTMEYRKKQRPLKIRMLDGTVKTIMVDDSKTVTDMLMTICARIGITNHDEYSLVRELMEEKKEE     71 - 140
ITGTLRKDKTLLRDEKKMEKLKQKLHTDDELNWLDHGRTLREQGVEEHETLLLRRKFFYSDQNVDSRDPV    141 - 210
QLNLLYVQARDDILNGSHPVSFDKACEFAGFQCQIQFGPHNEQKHKAGFLDLKDFLPKEYVKQKGERKIF    211 - 280
QAHKNCGQMSEIEAKVRYVKLARSLKTYGVSFFLVKEKMKGKNKLVPRLLGITKECVMRVDEKTKEVIQE    281 - 350
WNLTNIKRWAASPKSFTLDFGDYQDGYYSVQTTEGEQIAQLIAGYIDIILKKKKSKDHFGLEGDEESTML    351 - 420
EDSVSPKKSTVLQQQYNRVGKVEHGSVALPAIMRSGASGPENFQVGSMPPAQQQITSGQMHRGHMPPLTS    421 - 490
AQQALTGTINSSMQAVQAAQATLDDFDTLPPLGQDAASKAWRKNKMDESKHEIHSQVDAITAGTASVVNL    491 - 560
TAGDPAETDYTAVGCAVTTISSNLTEMSRGVKLLAALLEDEGGSGRPLLQAAKGLAGAVSELLRSAQPAS    561 - 630
AEPRQNLLQAAGNVGQASGELLQQIGESDTDPHFQDALMQLAKAVASAAAALVLKAKSVAQRTEDSGLQT    631 - 700
QVIAAATQCALSTSQLVACTKVVAPTISSPVCQEQLVEAGRLVAKAVEGCVSASQAATEDGQLLRGVGAA    701 - 770
ATAVTQALNELLQHVKAHATGAGPAGRYDQATDTILTVTENIFSSMGDAGEMVRQARILAQATSDLVNAI    771 - 840
KADAEGESDLENSRKLLSAAKILADATAKMVEAAKGAAAHPDSEEQQQRLREAAEGLRMATNAAAQNAIK    841 - 910
KKLVQRLEHAAKQAAASATQTIAAAQHAASTPKASAGPQPLLVQSCKAVAEQIPLLVQGVRGSQAQPDSP    911 - 980
SAQLALIAASQSFLQPGGKMVAAAKASVPTIQDQASAMQLSQCAKNLGTALAELRTAAQKAQEACGPLEM    981 - 1050
DSALSVVQNLEKDLQEVKAAARDGKLKPLPGETMEKCTQDLGNSTKAVSSAIAQLLGEVAQGNENYAGIA   1051 - 1120
ARDVAGGLRSLAQAARGVAALTSDPAVQAIVLDTASDVLDKASSLIEEAKKAAGHPGDPESQQRLAQVAK   1121 - 1190
AVTQALNRCVSCLPGQRDVDNALRAVGDASKRLLSDSLPPSTGTFQEAQSRLNEAAAGLNQAATELVQAS   1191 - 1260
RGTPQDLARASGRFGQDFSTFLEAGVEMAGQAPSQEDRAQVVSNLKGISMSSSKLLLAAKALSTDPAAPN   1261 - 1330
LKSQLAAAARAVTDSINQLITMCTQQAPGQKECDNALRELETVRELLENPVQPINDMSYFGCLDSVMENS   1331 - 1400
KVLGEAMTGISQNAKNGNLPEFGDAISTASKALCGFTEAAAQAAYLVGVSDPNSQAGQQGLVEPTQFARA   1401 - 1470
NQAIQMACQSLGEPGCTQAQVLSAATIVAKHTSALCNSCRLASARTTNPTAKRQFVQSAKEVANSTANLV   1471 - 1540
KTIKALDGAFTEENRAQCRAATAPLLEAVDNLSAFASNPEFSSIPAQISPEGRAAMEPIVISAKTMLESA   1541 - 1610
GGLIQTARALAVNPRDPPSWSVLAGHSRTVSDSIKKLITSMRDKAPGQLECETAIAALNSCLRDLDQASL   1611 - 1680
AAVSQQLAPREGISQEALHTQMLTAVQEISHLIEPLANAARAEASQLGHKVSQMAQYFEPLTLAAVGAAS   1681 - 1750
KTLSHPQQMALLDQTKTLAESALQLLYTAKEAGGNPKQAAHTQEALEEAVQMMTEAVEDLTTTLNEAASA   1751 - 1820
AGVVGGMVDSITQAINQLDEGPMGEPEGSFVDYQTTMVRTAKAIAVTVQEMVTKSNTSPEELGPLANQLT   1821 - 1890
SDYGRLASEAKPAAVAAENEEIGSHIKHRVQELGHGCAALVTKAGALQCSPSDAYTKKELIECARRVSEK   1891 - 1960
VSHVLAALQAGNRGTQACITAASAVSGIIADLDTTIMFATAGTLNREGTETFADHREGILKTAKVLVEDT   1961 - 2030
KVLVQNAAGSQEKLAQAAQSSVATITRLADVVKLGAASLGAEDPETQVVLINAVKDVAKALGDLISATKA   2031 - 2100
AAGKVGDDPAVWQLKNSAKVMVTNVTSLLKTVKAVEDEATKGTRALEATTEHIRQELAVFCSPEPPAKTS   2101 - 2170
TPEDFIRMTKGITMATAKAVAAGNSCRQEDVIATANLSRRAIADMLRACKEAAYHPEVAPDVRLRALHYG   2171 - 2240
RECANGYLELLDHVLLTLQKPSPELKQQLTGHSKRVAGSVTELIQAAEAMKGTEWVDPEDPTVIAENELL   2241 - 2310
GAAAAIEAAAKKLEQLKPRAKPKEADESLNFEEQILEAAKSIAAATSALVKAASAAQRELVAQGKVGAIP   2311 - 2380
ANALDDGQWSQGLISAARMVAAATNNLCEAANAAVQGHASQEKLISSAKQVAASTAQLLVACKVKADQDS   2381 - 2450
EAMKRLQAAGNAVKRASDNLVKAAQKAAAFEEQENETVVVKEKMVGGIAQIIAAQEEMLRKERELEEARK   2451 - 2520
KLAQIRQQQYKFLPSELRDEH                                                    2521 - 2541
//

Text Mined References (122)

PMID Year Title
26822056 2016 Both Talin-1 and Talin-2 correlate with malignancy potential of the human hepatocellular carcinoma MHCC-97 L cell.
26419705 2015 A RIAM/lamellipodin-talin-integrin complex forms the tip of sticky fingers that guide cell migration.
26336988 2015 Talin1 targeting potentiates anti-angiogenic therapy by attenuating invasion and stem-like features of glioblastoma multiforme.
26283369 2015 Talin determines the nanoscale architecture of focal adhesions.
26000342 2015 Non-monotonic cellular responses to heterogeneity in talin protein expression-level.
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
25925041 2015 High expression of Talin-1 is associated with poor prognosis in patients with nasopharyngeal carcinoma.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25233425 2014 Interactions of peripheral proteins with model membranes as viewed by molecular dynamics simulations.
25142525 2014 Actin flow and talin dynamics govern rigidity sensing in actin-integrin linkage through talin extension.
More...