Property Summary

NCBI Gene PubMed Count 22
PubMed Score 17.36
PubTator Score 26.09

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Expression

  Differential Expression (2)

Disease log2 FC p
medulloblastoma, large-cell -1.200 2.3e-04
ovarian cancer -2.000 5.3e-07

Synonym

Accession Q9Y484 A6NGH5 B7WPI2 Q5MNZ5 Q6IBS7 Q6NT94 Q96H03 WIPI-4
Symbols JM5
NBIA4
NBIA5
WDRX1
WIPI4
WIPI-4

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

Gene RIF (12)

AA Sequence

MTQQPLRGVTSLRFNQDQSCFCCAMETGVRIYNVEPLMEKGHLDHEQVGSMGLVEMLHRSNLLALVGGGS      1 - 70
SPKFSEISVLIWDDAREGKDSKEKLVLEFTFTKPVLSVRMRHDKIVIVLKNRIYVYSFPDNPRKLFEFDT     71 - 140
RDNPKGLCDLCPSLEKQLLVFPGHKCGSLQLVDLASTKPGTSSAPFTINAHQSDIACVSLNQPGTVVASA    141 - 210
SQKGTLIRLFDTQSKEKLVELRRGTDPATLYCINFSHDSSFLCASSDKGTVHIFALKDTRLNRRSALARV    211 - 280
GKVGPMIGQYVDSQWSLASFTVPAESACICAFGRNTSKNVNSVIAICVDGTFHKYVFTPDGNCNREAFDV    281 - 350
YLDICDDDDF                                                                351 - 360
//

Text Mined References (21)

PMID Year Title