Property Summary

NCBI Gene PubMed Count 141
PubMed Score 28.83
PubTator Score 40.05

Knowledge Summary

Patent (1,262)

Expression

  Differential Expression (6)

Disease log2 FC p
osteosarcoma -1.601 0.000
group 4 medulloblastoma 1.200 0.002
medulloblastoma, large-cell 1.200 0.000
subependymal giant cell astrocytoma -1.160 0.040
ovarian cancer 1.300 0.000
Gaucher disease type 1 -1.600 0.003

Synonym

Accession Q9Y478 Q9UBV0 Q9UE20 Q9UEX2 Q9Y6V8 AMPK subunit beta-1
Symbols AMPK
HAMPKb

Gene

PANTHER Protein Class (2)

PDB

4CFE   4CFF   4ZHX   5EZV  

 Collection (1)

MLP Assay (1)

AID Type Active / Inconclusive / Inactive Description
686923 other 8 / 0 / 2 In vitrocounter assay of key BMP4 Inhibitors

Gene RIF (112)

PMID Text
25940306 Salicylate activates the AMP-activated protein kinase (AMPK) by binding at the A-769662 drug binding site on the AMPK beta1-subunit
24602453 findings suggest that the reduced expression of AMPK-beta1 confers lower AMPK activity, which enhances the oncogenic capacity of advanced-stage ovarian cancer.
24414799 HIV-1 Tat-induced LTR transactivation is reversed by tanshinone II A through the AMPK-Nampt pathway
23515442 Data indicate that a diet high in iron improves glucose tolerance by activating AMPK through mechanisms that include deacetylation.
23396401 LKB1 controls IRS1-dependent adipogenesis via AMPK in white adipose tissue.
23266705 The effects of ethanol on AMPK and PP2A may result in activation of ChREBP, providing another potential mechanism for ethanol-induced hepatic steatosis.
22897928 Data indicate that except AMPK-alpha1, expressions of the other five AMPK subunits -alpha2, -beta1, -beta2, -gamma1 and -gamma2 are significantly higher in ovarian carcinomas.
22435535 Changes in translational control of mitochondrial proteins are signaled by the activation of AMPK and general control non-derepressible kinase 2 (GCN2), leading also to the activation of autophagy.
22363791 In breast cancer cells SESN2 is associated with AMPK.
22323564 Adipose tissues of markedly obese insulin resistant individuals uniformly show decreased AMPK activity and increased oxidative stress compared with insulin sensitive patients.
More...

AA Sequence

MGNTSSERAALERHGGHKTPRRDSSGGTKDGDRPKILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLEVN      1 - 70
DKAPAQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSHNNFVAILDLPEGEHQYKFFVDGQWTHDPSEP     71 - 140
IVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELSSSPPGPYHQEPYVCKPEERFRAPPILPPHL    141 - 210
LQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI              211 - 270
//

Publication (154)

PMID Year Title
25940306 2015 Salicylate activates AMPK and synergizes with metformin to reduce the survival of prostate and lung cancer cells ex vivo through inhibition of de novo lipogenesis.
25852190 2015 Integrative analysis of kinase networks in TRAIL-induced apoptosis provides a source of potential targets for combination therapy.
24602453 2014 Reduced expression of AMPK-?1 during tumor progression enhances the oncogenic capacity of advanced ovarian cancer.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23515442 2013 Iron regulates glucose homeostasis in liver and muscle via AMP-activated protein kinase in mice.
23455922 2013 Interlaboratory reproducibility of large-scale human protein-complex analysis by standardized AP-MS.
23396401 2013 Liver kinase b1 is required for white adipose tissue growth and differentiation.
23266705 2013 Activation of carbohydrate response element-binding protein by ethanol.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22897928 2012 Over-expressions of AMPK subunits in ovarian carcinomas with significant clinical implications.
More...