Property Summary

NCBI Gene PubMed Count 142
PubMed Score 32.47
PubTator Score 40.05

Knowledge Summary

Patent (1,262)

TINX Plot

  Disease (2)

Expression

  Differential Expression (6)

Disease log2 FC p
Gaucher disease type 1 -1.600 3.3e-03
group 4 medulloblastoma 1.200 2.4e-03
medulloblastoma, large-cell 1.200 8.0e-05
osteosarcoma -1.601 8.7e-07
ovarian cancer 1.300 1.3e-05
subependymal giant cell astrocytoma -1.160 4.0e-02

Gene RIF (113)

AA Sequence

MGNTSSERAALERHGGHKTPRRDSSGGTKDGDRPKILMDSPEDADLFHSEEIKAPEKEEFLAWQHDLEVN      1 - 70
DKAPAQARPTVFRWTGGGKEVYLSGSFNNWSKLPLTRSHNNFVAILDLPEGEHQYKFFVDGQWTHDPSEP     71 - 140
IVTSQLGTVNNIIQVKKTDFEVFDALMVDSQKCSDVSELSSSPPGPYHQEPYVCKPEERFRAPPILPPHL    141 - 210
LQVILNKDTGISCDPALLPEPNHVMLNHLYALSIKDGVMVLSATHRYKKKYVTTLLYKPI              211 - 270
//

Text Mined References (155)

PMID Year Title