Property Summary

NCBI Gene PubMed Count 17
PubMed Score 8.35
PubTator Score 15.26

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Disease Target Count P-value
ovarian cancer 8520 1.4e-07
tuberculosis and treatment for 3 months 179 2.9e-05
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.8
Disease Target Count Z-score Confidence
Rheumatoid arthritis 1191 0.0 2.2
Disease Target Count Z-score Confidence
Encephalitis 64 3.835 1.9

Expression

  Differential Expression (2)

Disease log2 FC p
ovarian cancer -1.200 1.4e-07
tuberculosis and treatment for 3 months -1.300 2.9e-05

Gene RIF (13)

AA Sequence

MPADVNLSQKPQVLGPEKQDGSCEASVSFEDVTVDFSREEWQQLDPAQRCLYRDVMLELYSHLFAVGYHI      1 - 70
PNPEVIFRMLKEKEPRVEEAEVSHQRCQEREFGLEIPQKEISKKASFQKDMVGEFTRDGSWCSILEELRL     71 - 140
DADRTKKDEQNQIQPMSHSAFFNKKTLNTESNCEYKDPGKMIRTRPHLASSQKQPQKCCLFTESLKLNLE    141 - 210
VNGQNESNDTEQLDDVVGSGQLFSHSSSDACSKNIHTGETFCKGNQCRKVCGHKQSLKQHQIHTQKKPDG    211 - 280
CSECGGSFTQKSHLFAQQRIHSVGNLHECGKCGKAFMPQLKLSVYLTDHTGDIPCICKECGKVFIQRSEL    281 - 350
LTHQKTHTRKKPYKCHDCGKAFFQMLSLFRHQRTHSREKLYECSECGKGFSQNSTLIIHQKIHTGERQYA    351 - 420
CSECGKAFTQKSTLSLHQRIHSGQKSYVCIECGQAFIQKAHLIVHQRSHTGEKPYQCHNCGKSFISKSQL    421 - 490
DIHHRIHTGEKPYECSDCGKTFTQKSHLNIHQKIHTGERHHVCSECGKAFNQKSILSMHQRIHTGEKPYK    491 - 560
CSECGKAFTSKSQFKEHQRIHTGEKPYVCTECGKAFNGRSNFHKHQITHTRERPFVCYKCGKAFVQKSEL    561 - 630
ITHQRTHMGEKPYECLDCGKSFSKKPQLKVHQRIHTGERPYVCSECGKAFNNRSNFNKHQTTHTRDKSYK    631 - 700
CSYSVKGFTKQ                                                               701 - 711
//

Text Mined References (18)

PMID Year Title