Property Summary

NCBI Gene PubMed Count 16
Grant Count 13
R01 Count 5
Funding $741,440.01
PubMed Score 8.35
PubTator Score 15.26

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (2)

Disease log2 FC p
tuberculosis and treatment for 3 months -1.300 0.000
ovarian cancer -1.200 0.000

Gene RIF (13)

PMID Text
20379614 Clinical trial of gene-disease association and gene-environment interaction. (HuGE Navigator)
19247725 OTK18 may play a role in neurotrophin production and consequently support neuronal survival.
19034670 HIV-1 induces OTK18 expression through a YIN-YANG-1 mediated manner in human macrophages
19034670 OTK18 suppresses HIV-1 Tat-induced LTR promoter activity. The Kruppel-associated box (amino acids 1-115) and zinc finger regions (amino acids 300-711) of OTK18 are responsible for the transcriptional suppressive activities
19034669 These data suggest that calpain and proteasome are involved in OTK18 endoproteolysis and degradation
19034669 OTK18 suppresses HIV-1 Tat-induced LTR promoter activity. The Kruppel-associated box (amino acids 1-115) and zinc finger regions (amino acids 300-711) of OTK18 are responsible for the transcriptional suppressive activities
18776638 These results suggest a role for OTK18 in innate immunity.
18773297 Plasma OTK18 levels are positively correlated to CD8 T-cell counts, independent of HIV-1 status.
17170456 OTK18 suppresses HIV-1 Tat-induced LTR promoter activity. The Kruppel-associated box (amino acids 1-115) and zinc finger regions (amino acids 300-711) of OTK18 are responsible for the transcriptional suppressive activities
15081264 OTK18/zinc finger protein 175 expression in brain mononuclear phagocytes is a signature for advanced HIV-1 encephalitis.
More...

AA Sequence

MPADVNLSQKPQVLGPEKQDGSCEASVSFEDVTVDFSREEWQQLDPAQRCLYRDVMLELYSHLFAVGYHI      1 - 70
PNPEVIFRMLKEKEPRVEEAEVSHQRCQEREFGLEIPQKEISKKASFQKDMVGEFTRDGSWCSILEELRL     71 - 140
DADRTKKDEQNQIQPMSHSAFFNKKTLNTESNCEYKDPGKMIRTRPHLASSQKQPQKCCLFTESLKLNLE    141 - 210
VNGQNESNDTEQLDDVVGSGQLFSHSSSDACSKNIHTGETFCKGNQCRKVCGHKQSLKQHQIHTQKKPDG    211 - 280
CSECGGSFTQKSHLFAQQRIHSVGNLHECGKCGKAFMPQLKLSVYLTDHTGDIPCICKECGKVFIQRSEL    281 - 350
LTHQKTHTRKKPYKCHDCGKAFFQMLSLFRHQRTHSREKLYECSECGKGFSQNSTLIIHQKIHTGERQYA    351 - 420
CSECGKAFTQKSTLSLHQRIHSGQKSYVCIECGQAFIQKAHLIVHQRSHTGEKPYQCHNCGKSFISKSQL    421 - 490
DIHHRIHTGEKPYECSDCGKTFTQKSHLNIHQKIHTGERHHVCSECGKAFNQKSILSMHQRIHTGEKPYK    491 - 560
CSECGKAFTSKSQFKEHQRIHTGEKPYVCTECGKAFNGRSNFHKHQITHTRERPFVCYKCGKAFVQKSEL    561 - 630
ITHQRTHMGEKPYECLDCGKSFSKKPQLKVHQRIHTGERPYVCSECGKAFNNRSNFNKHQTTHTRDKSYK    631 - 700
CSYSVKGFTKQ                                                               701 - 711
//

Text Mined References (17)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
22491018 2013 Genome-wide association analysis implicates the involvement of eight loci with response to tocilizumab for the treatment of rheumatoid arthritis.
20379614 Personalized smoking cessation: interactions between nicotine dose, dependence and quit-success genotype score.
19247725 The effect of OTK18 upregulation in U937 cells on neuronal survival.
19034670 2009 YY1 and FoxD3 regulate antiretroviral zinc finger protein OTK18 promoter activation induced by HIV-1 infection.
19034669 2009 Calpain and proteasomal regulation of antiretroviral zinc finger protein OTK18 in human macrophages: visualization in live cells by intramolecular FRET.
18776638 2008 Characterization of gene expression regulated by human OTK18 using Drosophila melanogaster as a model system for innate immunity.
18773297 2008 OTK18 levels in plasma and cerebrospinal fluid correlate with viral load and CD8 T-cells in normal and AIDS patients.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...