Property Summary

NCBI Gene PubMed Count 20
PubMed Score 57.31
PubTator Score 6.50

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (13)

Disease log2 FC p
active ulcerative colitis -2.537 1.6e-02
adrenocortical carcinoma -1.111 1.8e-02
colon cancer -2.300 8.0e-05
cystic fibrosis -1.600 1.6e-03
interstitial cystitis 2.000 7.0e-04
intraductal papillary-mucinous neoplasm ... -1.300 4.8e-04
lung cancer -4.200 2.1e-05
lung carcinoma -2.900 1.4e-18
nasopharyngeal carcinoma -1.100 5.1e-03
non-small cell lung cancer -2.329 2.8e-14
osteosarcoma -2.467 1.5e-02
ovarian cancer -4.000 3.8e-16
psoriasis -2.400 3.4e-08

Gene RIF (4)

AA Sequence

MDENNGLLLLELNPPNPWDLQPRSPEELAFGEVQITYLTHACMDLKLGDKRMVFDPWLIGPAFARGWWLL      1 - 70
HEPPSDWLERLCQADLIYISHLHSDHLSYPTLKKLAGRRPDIPIYVGNTERPVFWNLNQSGVQLTNINVV     71 - 140
PFGIWQQVDKNLRFMILMDGVHPEMDTCIIVEYKGHKILNIVDCTRPNGGRLPMKVALMMSDFAGGASGF    141 - 210
PMTFSGGKFTEEWKAQFIKTERKKLLNYKARLVKNLQPRIYCPFAGYFVESHPSDKYIKETNTKNDPNEL    211 - 280
NNLIKKNSDVITWTPRPGATLDLGRMLKDRTDSKGIIEPPEGTKIYKDSWDFEPYLEILNAALGDEIFLH    281 - 350
SSWIKEYFTWAGFKDYNLVVRMIETDEDFNPFPGGYDYLVDFLDLSFPKERPQREHPYEEIHSRVDVIRH    351 - 420
VVKNGLLWDELYIGFQTRLQRDPDIYHHLFWNHFQIKLPLTPPNWKSFLMCCEQNGPVILQFSTERTNEP    421 - 490
NRNKFSVENKA                                                               491 - 501
//

Text Mined References (20)

PMID Year Title