Property Summary

NCBI Gene PubMed Count 32
Grant Count 70
R01 Count 43
Funding $11,320,535.01
PubMed Score 274.05
PubTator Score 27.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
ependymoma 1.700 0.003
oligodendroglioma 1.400 0.003
osteosarcoma -2.089 0.000
medulloblastoma -2.000 0.001
atypical teratoid / rhabdoid tumor -1.100 0.021
glioblastoma -2.000 0.000
medulloblastoma, large-cell -3.000 0.001
lung cancer 2.100 0.009
pediatric high grade glioma -1.500 0.001
lung adenocarcinoma 1.400 0.000
ovarian cancer -1.200 0.000

Synonym

Accession Q9Y468 B4DRC9 E1P5W7 Q5H8Y8 Q5H8Y9 Q8IUV7 Q9H1E6 Q9H1G5 Q9UG06 Q9UJB9 Q9Y4C9 H-l(3)mbt
Symbols L3MBTL
ZC2HC3
H-L(3)MBT
dJ138B7.3

Gene

PDB

3OQ5   1OYX   1OZ2   1OZ3   2PQW   2RHI   2RHU   2RHX   2RHY   2RHZ   2RI2   2RI3   2RI5   2RJC   2RJD   2RJE   2RJF   3P8H   3UWN  

MLP Assay (3)

AID Type Active / Inconclusive / Inactive Description
485292 summary 0 / 0 / 0 Probe Development Summary for Inhibitors of L3MBTL1
485360 confirmatory 1495 / 6845 / 217165 qHTS Assay for the Inhibitors of L3MBTL1
540279 confirmatory 454 / 44 / 0 qHTS Assay for the Inhibitors of L3MBTL1: Hit Validation

Gene RIF (14)

PMID Text
25754204 The polycomb group protein L3MBTL1 represses a SMAD5-mediated hematopoietic transcriptional program in human pluripotent stem cells.
24243547 Data indicate that germline genes, some of which drive oncogenesis in Drosophila melanogaster, are similarly ectopically activated in a wide range of human cancers.
21837478 High expression of L3MBTL1 was associated with low grade and hormone receptor-positive tumors, as well as low risk of disease recurrence and breast cancer death.
21341991 depletion of L3MBTL1 does not affect hESC self-renewal, rather it enhances differentiation toward extra-embryonic trophoblast tissues
21149733 Data suggest that the loss of L3MBTL1 contributes to the development of 20q(-) hematopoietic malignancies by inducing replicative stress, DNA damage, and genomic instability.
20870725 SET8-mediated methylation of p53 at Lys-382 promotes the interaction between L3MBTL1 and p53 in cells.
20585043 haploinsufficiency of L3MBTL1 contributes to some (20q-) myeloproliferative neoplasms, especially polycythemia vera, by promoting erythroid differentiation
18408754 H4K20 monomethylation and PR-SET7 are important for L3MBTL1 function
18042461 The structural and binding studies of the two modules provide insights into the molecular principles governing the decoding of lysine methylation states, thereby highlighting a methylation state-specific layer of histone mark readout.
18026117 An unexpected mode of peptide-mediated dimerization suggests a possible mechanism for chromatin compaction by L3MBTL1
More...

AA Sequence

MRRREGHGTDSEMGQGPVRESQSSDPPALQFRISEYKPLNMAGVEQPPSPELRQEGVTEYEDGGAPAGDG      1 - 70
EAGPQQAEDHPQNPPEDPNQDPPEDDSTCQCQACGPHQAAGPDLGSSNDGCPQLFQERSVIVENSSGSTS     71 - 140
ASELLKPMKKRKRREYQSPSEEESEPEAMEKQEEGKDPEGQPTASTPESEEWSSSQPATGEKKECWSWES    141 - 210
YLEEQKAITAPVSLFQDSQAVTHNKNGFKLGMKLEGIDPQHPSMYFILTVAEVCGYRLRLHFDGYSECHD    211 - 280
FWVNANSPDIHPAGWFEKTGHKLQPPKGYKEEEFSWSQYLRSTRAQAAPKHLFVSQSHSPPPLGFQVGMK    281 - 350
LEAVDRMNPSLVCVASVTDVVDSRFLVHFDNWDDTYDYWCDPSSPYIHPVGWCQKQGKPLTPPQDYPDPD    351 - 420
NFCWEKYLEETGASAVPTWAFKVRPPHSFLVNMKLEAVDRRNPALIRVASVEDVEDHRIKIHFDGWSHGY    421 - 490
DFWIDADHPDIHPAGWCSKTGHPLQPPLGPREPSSASPGGCPPLSYRSLPHTRTSKYSFHHRKCPTPGCD    491 - 560
GSGHVTGKFTAHHCLSGCPLAERNQSRLKAELSDSEASARKKNLSGFSPRKKPRHHGRIGRPPKYRKIPQ    561 - 630
EDFQTLTPDVVHQSLFMSALSAHPDRSLSVCWEQHCKLLPGVAGISASTVAKWTIDEVFGFVQTLTGCED    631 - 700
QARLFKDEMIDGEAFLLLTQADIVKIMSVKLGPALKIYNAILMFKNADDTLK                      701 - 752
//

Publication (35)

PMID Year Title
25754204 2015 The polycomb group protein L3MBTL1 represses a SMAD5-mediated hematopoietic transcriptional program in human pluripotent stem cells.
24243547 2014 Meta-analysis of expression of l(3)mbt tumor-associated germline genes supports the model that a soma-to-germline transition is a hallmark of human cancers.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22120668 2011 The AAA-ATPase VCP/p97 promotes 53BP1 recruitment by removing L3MBTL1 from DNA double-strand breaks.
21837478 2012 Physical activity and breast cancer survival: an epigenetic link through reduced methylation of a tumor suppressor gene L3MBTL1.
21341991 2011 L3MBTL1 deficiency directs the differentiation of human embryonic stem cells toward trophectoderm.
21149733 2010 L3MBTL1 polycomb protein, a candidate tumor suppressor in del(20q12) myeloid disorders, is essential for genome stability.
20870725 2010 The MBT repeats of L3MBTL1 link SET8-mediated p53 methylation at lysine 382 to target gene repression.
20870719 2010 Methylation of the retinoblastoma tumor suppressor by SMYD2.
20622853 2010 Histone H4K20/H3K9 demethylase PHF8 regulates zebrafish brain and craniofacial development.
More...