Property Summary

Ligand Count 1
NCBI Gene PubMed Count 33
PubMed Score 284.50
PubTator Score 27.43

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (11)

Disease log2 FC p
adult high grade glioma -1.200 6.5e-03
atypical teratoid / rhabdoid tumor -1.100 2.1e-02
ependymoma 1.200 1.2e-02
glioblastoma -2.000 2.2e-04
group 4 medulloblastoma -2.000 6.9e-04
lung adenocarcinoma 1.400 4.1e-05
lung cancer 1.400 1.6e-02
medulloblastoma, large-cell -3.000 5.3e-04
oligodendroglioma 1.400 2.9e-03
osteosarcoma -1.817 1.9e-05
ovarian cancer -1.200 6.5e-07

Gene RIF (15)

AA Sequence

MRRREGHGTDSEMGQGPVRESQSSDPPALQFRISEYKPLNMAGVEQPPSPELRQEGVTEYEDGGAPAGDG      1 - 70
EAGPQQAEDHPQNPPEDPNQDPPEDDSTCQCQACGPHQAAGPDLGSSNDGCPQLFQERSVIVENSSGSTS     71 - 140
ASELLKPMKKRKRREYQSPSEEESEPEAMEKQEEGKDPEGQPTASTPESEEWSSSQPATGEKKECWSWES    141 - 210
YLEEQKAITAPVSLFQDSQAVTHNKNGFKLGMKLEGIDPQHPSMYFILTVAEVCGYRLRLHFDGYSECHD    211 - 280
FWVNANSPDIHPAGWFEKTGHKLQPPKGYKEEEFSWSQYLRSTRAQAAPKHLFVSQSHSPPPLGFQVGMK    281 - 350
LEAVDRMNPSLVCVASVTDVVDSRFLVHFDNWDDTYDYWCDPSSPYIHPVGWCQKQGKPLTPPQDYPDPD    351 - 420
NFCWEKYLEETGASAVPTWAFKVRPPHSFLVNMKLEAVDRRNPALIRVASVEDVEDHRIKIHFDGWSHGY    421 - 490
DFWIDADHPDIHPAGWCSKTGHPLQPPLGPREPSSASPGGCPPLSYRSLPHTRTSKYSFHHRKCPTPGCD    491 - 560
GSGHVTGKFTAHHCLSGCPLAERNQSRLKAELSDSEASARKKNLSGFSPRKKPRHHGRIGRPPKYRKIPQ    561 - 630
EDFQTLTPDVVHQSLFMSALSAHPDRSLSVCWEQHCKLLPGVAGISASTVAKWTIDEVFGFVQTLTGCED    631 - 700
QARLFKDEMIDGEAFLLLTQADIVKIMSVKLGPALKIYNAILMFKNADDTLK                      701 - 752
//

Text Mined References (36)

PMID Year Title