Property Summary

NCBI Gene PubMed Count 24
Grant Count 18
R01 Count 5
Funding $2,476,841.83
PubMed Score 46.75
PubTator Score 24.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
malignant mesothelioma -1.400 0.000
astrocytoma 1.700 0.023
oligodendroglioma 1.400 0.001
atypical teratoid / rhabdoid tumor 1.300 0.004
colon cancer -1.400 0.001
posterior fossa group B ependymoma 1.100 0.000
subependymal giant cell astrocytoma -1.326 0.029
Breast cancer -1.500 0.004

Gene RIF (13)

PMID Text
25608837 Mechanisms of silencing SALL2 in OVCA cell lines and primary tumors and possible therapeutic approaches for ovarian carcinoma are discussed in this review.
25580951 Sall2 enhanced the p16 minigene blocking of cell cycle progression and p16 knockdown with siRNA abolished most of the Sall2 inhibition of cell cycle progression
24412933 A role for SALL2 in eye morphogenesis and loss of function of the gene causes ocular coloboma in humans and mice.
23273547 The SALL2 P2 promoter is hypermethylated in a majority of serous ovarian carcinomas.
23029531 c-MYC may come under negative regulation by p150, consistent with the action of p150 as a putative tumor suppressor.
21791360 Here, the authors report that human papillomavirus type 16 E6 targets the cellular factor p150(Sal2), which positively regulates p21(WAF1) transcription.
21362508 Results demonstrate binding of p150(Sal2) to two natural promoters with GC elements related to the optimal binding sequence defined in vitro and whose regulation is important for suppression of tumor growth.
21228219 A CUL4/DDB1 E3 ligase containing RBBP7 as the p150(Sal2) receptor has been identified as mediating the destruction of p150(Sal2) as cells transition from a quiescent to an actively growing state.
20634891 Observational study of gene-disease association. (HuGE Navigator)
19247946 Studies indicate that vertebrate sal orthologues (spalt-like/sall) have important developmental roles during neural development and organogenesis and gentic diseases.
More...

AA Sequence

MSRRKQRKPQQLISDCEGPSASENGDASEEDHPQVCAKCCAQFTDPTEFLAHQNACSTDPPVMVIIGGQE      1 - 70
NPNNSSASSEPRPEGHNNPQVMDTEHSNPPDSGSSVPTDPTWGPERRGEESPGHFLVAATGTAAGGGGGL     71 - 140
ILASPKLGATPLPPESTPAPPPPPPPPPPPGVGSGHLNIPLILEELRVLQQRQIHQMQMTEQICRQVLLL    141 - 210
GSLGQTVGAPASPSELPGTGTASSTKPLLPLFSPIKPVQTSKTLASSSSSSSSSSGAETPKQAFFHLYHP    211 - 280
LGSQHPFSAGGVGRSHKPTPAPSPALPGSTDQLIASPHLAFPSTTGLLAAQCLGAARGLEATASPGLLKP    281 - 350
KNGSGELSYGEVMGPLEKPGGRHKCRFCAKVFGSDSALQIHLRSHTGERPYKCNVCGNRFTTRGNLKVHF    351 - 420
HRHREKYPHVQMNPHPVPEHLDYVITSSGLPYGMSVPPEKAEEEAATPGGGVERKPLVASTTALSATESL    421 - 490
TLLSTSAGTATAPGLPAFNKFVLMKAVEPKNKADENTPPGSEGSAISGVAESSTATRMQLSKLVTSLPSW    491 - 560
ALLTNHFKSTGSFPFPYVLEPLGASPSETSKLQQLVEKIDRQGAVAVTSAASGAPTTSAPAPSSSASSGP    561 - 630
NQCVICLRVLSCPRALRLHYGQHGGERPFKCKVCGRAFSTRGNLRAHFVGHKASPAARAQNSCPICQKKF    631 - 700
TNAVTLQQHVRMHLGGQIPNGGTALPEGGGAAQENGSEQSTVSGAGSFPQQQSQQPSPEEELSEEEEEED    701 - 770
EEEEEDVTDEDSLAGRGSESGGEKAISVRGDSEEASGAEEEVGTVAAAATAGKEMDSNEKTTQQSSLPPP    771 - 840
PPPDSLDQPQPMEQGSSGVLGGKEEGGKPERSSSPASALTPEGEATSVTLVEELSLQEAMRKEPGESSSR    841 - 910
KACEVCGQAFPSQAALEEHQKTHPKEGPLFTCVFCRQGFLERATLKKHMLLAHHQVQPFAPHGPQNIAAL    911 - 980
SLVPGCSPSITSTGLSPFPRKDDPTIP                                               981 - 1007
//

Publication (32)

PMID Year Title
25608837 2015 The tumor suppressor protein p150(Sal2) in carcinogenesis.
25580951 2015 Sal-like protein 2 upregulates p16 expression through a proximal promoter element.
25416956 2014 A proteome-scale map of the human interactome network.
24412933 2014 Mutation of SALL2 causes recessive ocular coloboma in humans and mice.
23273547 2013 Promoter methylation of the SALL2 tumor suppressor gene in ovarian cancers.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
23029531 2012 The polyoma virus large T binding protein p150 is a transcriptional repressor of c-MYC.
21791360 2011 Human papillomavirus type 16 E6 inhibits p21(WAF1) transcription independently of p53 by inactivating p150(Sal2).
21406692 2011 System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation.
21362508 DNA-binding and regulatory properties of the transcription factor and putative tumor suppressor p150(Sal2).
More...