Property Summary

NCBI Gene PubMed Count 25
PubMed Score 51.08
PubTator Score 24.43

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
astrocytic glioma 1.300 1.2e-02
atypical teratoid / rhabdoid tumor 1.300 3.6e-03
Breast cancer -1.500 4.4e-03
colon cancer -1.400 6.9e-04
malignant mesothelioma -1.400 2.5e-06
oligodendroglioma 1.400 8.8e-04
posterior fossa group B ependymoma 1.100 2.8e-07
subependymal giant cell astrocytoma -1.326 2.9e-02

Gene RIF (14)

AA Sequence

MSRRKQRKPQQLISDCEGPSASENGDASEEDHPQVCAKCCAQFTDPTEFLAHQNACSTDPPVMVIIGGQE      1 - 70
NPNNSSASSEPRPEGHNNPQVMDTEHSNPPDSGSSVPTDPTWGPERRGEESPGHFLVAATGTAAGGGGGL     71 - 140
ILASPKLGATPLPPESTPAPPPPPPPPPPPGVGSGHLNIPLILEELRVLQQRQIHQMQMTEQICRQVLLL    141 - 210
GSLGQTVGAPASPSELPGTGTASSTKPLLPLFSPIKPVQTSKTLASSSSSSSSSSGAETPKQAFFHLYHP    211 - 280
LGSQHPFSAGGVGRSHKPTPAPSPALPGSTDQLIASPHLAFPSTTGLLAAQCLGAARGLEATASPGLLKP    281 - 350
KNGSGELSYGEVMGPLEKPGGRHKCRFCAKVFGSDSALQIHLRSHTGERPYKCNVCGNRFTTRGNLKVHF    351 - 420
HRHREKYPHVQMNPHPVPEHLDYVITSSGLPYGMSVPPEKAEEEAATPGGGVERKPLVASTTALSATESL    421 - 490
TLLSTSAGTATAPGLPAFNKFVLMKAVEPKNKADENTPPGSEGSAISGVAESSTATRMQLSKLVTSLPSW    491 - 560
ALLTNHFKSTGSFPFPYVLEPLGASPSETSKLQQLVEKIDRQGAVAVTSAASGAPTTSAPAPSSSASSGP    561 - 630
NQCVICLRVLSCPRALRLHYGQHGGERPFKCKVCGRAFSTRGNLRAHFVGHKASPAARAQNSCPICQKKF    631 - 700
TNAVTLQQHVRMHLGGQIPNGGTALPEGGGAAQENGSEQSTVSGAGSFPQQQSQQPSPEEELSEEEEEED    701 - 770
EEEEEDVTDEDSLAGRGSESGGEKAISVRGDSEEASGAEEEVGTVAAAATAGKEMDSNEKTTQQSSLPPP    771 - 840
PPPDSLDQPQPMEQGSSGVLGGKEEGGKPERSSSPASALTPEGEATSVTLVEELSLQEAMRKEPGESSSR    841 - 910
KACEVCGQAFPSQAALEEHQKTHPKEGPLFTCVFCRQGFLERATLKKHMLLAHHQVQPFAPHGPQNIAAL    911 - 980
SLVPGCSPSITSTGLSPFPRKDDPTIP                                               981 - 1007
//

Text Mined References (33)

PMID Year Title