Property Summary

NCBI Gene PubMed Count 41
PubMed Score 50.00
PubTator Score 21.58

Knowledge Summary

Patent (15,849)

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma -2.600 2.9e-03
Astrocytoma, Pilocytic -2.300 6.9e-04
ependymoma -3.000 2.6e-03
group 3 medulloblastoma -3.400 8.9e-03
medulloblastoma, large-cell -2.900 9.9e-03
oligodendroglioma -2.100 8.7e-03
subependymal giant cell astrocytoma 3.443 2.7e-02

 GO Component (1)

Protein-protein Interaction (9)

Gene RIF (33)

AA Sequence

MSKPAGSTSRILDIPCKVCGDRSSGKHYGVYACDGCSGFFKRSIRRNRTYVCKSGNQGGCPVDKTHRNQC      1 - 70
RACRLKKCLEVNMNKDAVQHERGPRTSTIRKQVALYFRGHKEENGAAAHFPSAALPAPAFFTAVTQLEPH     71 - 140
GLELAAVSTTPERQTLVSLAQPTPKYPHEVNGTPMYLYEVATESVCESAARLLFMSIKWAKSVPAFSTLS    141 - 210
LQDQLMLLEDAWRELFVLGIAQWAIPVDANTLLAVSGMNGDNTDSQKLNKIISEIQALQEVVARFRQLRL    211 - 280
DATEFACLKCIVTFKAVPTHSGSELRSFRNAAAIAALQDEAQLTLNSYIHTRYPTQPCRFGKLLLLLPAL    281 - 350
RSISPSTIEEVFFKKTIGNVPITRLLSDMYKSSDI                                       351 - 385
//

Text Mined References (42)

PMID Year Title