Property Summary

NCBI Gene PubMed Count 39
PubMed Score 44.20
PubTator Score 21.58

Knowledge Summary

Patent (15,849)

TINX Plot

  Disease Sources (1)

Disease Target Count P-value
posterior fossa group A ependymoma 1511 1.80562092136788E-9
medulloblastoma 1524 8.55856308090709E-6
pilocytic astrocytoma 3086 8.05817467189597E-4
astrocytic glioma 2241 0.00292356714635872
oligodendroglioma 2849 0.00872023910850447
medulloblastoma, large-cell 6234 0.00989514646802035
subependymal giant cell astrocytoma 2287 0.0267674352621099

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma -2.600 0.003
posterior fossa group A ependymoma -3.100 0.000
oligodendroglioma -2.100 0.009
medulloblastoma -3.400 0.000
medulloblastoma, large-cell -2.900 0.010
pilocytic astrocytoma -2.300 0.001
subependymal giant cell astrocytoma 3.443 0.027

Synonym

Accession Q9Y466 Q6ZMP8
Symbols TLL
TLX
XTLL

Gene

PDB

4XAJ  

  Ortholog (15)

  TechDev Info (1)

Jun Qin Signaling network evaluation of transcript factor crosstalk via catTRE/MS

 GO Component (1)

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
2277 screening 14 / 0 / 0 Center Based Initiative to identify novel modulators of the Retinoic acid receptor-related Orphan Receptors (ROR): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors.
504934 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify inverse agonists of the liver receptor homolog-1 (LRH-1; NR5A2): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors

Gene RIF (31)

PMID Text
26965827 TLX and miR-219 have an important role in both normal neurodevelopment and in schizophrenia patient iPSC-derived NSCs. TLX has a role in regulating microRNA processing, independent of its well-characterized role in transcriptional regulation.
26838672 TLX downregulation induces TET3 expression and inhibits glioblastoma tumorigenesis and self-renewal in glioblastoma stem cells.
26554934 TLX biological role in mental illness and gliomagenesis
26280373 TLX has a role in regulating growth and invasion in ERalpha-negative breast cancer cells
25813674 Increased NR2E1 level may be closely associated with inflammation and disorder of lipid and glucose metabolism in diabetic patients.
25557355 TLX functions as a potent suppressor of oncogene-induced senescence in prostate cancer via its transcriptional co-regulation of the CDKN1A (p21(WAF1) (/) (CIP1) ) and SIRT1 genes
25356871 The effect of TLX on the proliferative, invasive and migratory properties of IMR-32 cells attributed to the recruitment of TLX to both MMP-2 and Oct-4 gene promoters, which resulted in the respective gene activation.
25328137 NR2E1 regulates CBX7 and restrains senescence in neural stem cells.
25327364 These results suggest that let-7b, by forming a negative feedback loop with TLX, provides a novel model to regulate the proliferation and differentiation of retinal progenitors in vitro
23975195 TLX/NR2E1 and related NRs such as PNR and COUPTFs can selectively associate with the developmental corepressor BCL11A via a conserved motif F/YSXXLXXL/Y within the RID1 and RID2 domains. The interaction with BCL11A facilitates TLX-mediated repression of the RARb2 gene.
More...

AA Sequence

MSKPAGSTSRILDIPCKVCGDRSSGKHYGVYACDGCSGFFKRSIRRNRTYVCKSGNQGGCPVDKTHRNQC      1 - 70
RACRLKKCLEVNMNKDAVQHERGPRTSTIRKQVALYFRGHKEENGAAAHFPSAALPAPAFFTAVTQLEPH     71 - 140
GLELAAVSTTPERQTLVSLAQPTPKYPHEVNGTPMYLYEVATESVCESAARLLFMSIKWAKSVPAFSTLS    141 - 210
LQDQLMLLEDAWRELFVLGIAQWAIPVDANTLLAVSGMNGDNTDSQKLNKIISEIQALQEVVARFRQLRL    211 - 280
DATEFACLKCIVTFKAVPTHSGSELRSFRNAAAIAALQDEAQLTLNSYIHTRYPTQPCRFGKLLLLLPAL    281 - 350
RSISPSTIEEVFFKKTIGNVPITRLLSDMYKSSDI                                       351 - 385
//

Text Mined References (40)

PMID Year Title
26965827 2016 The TLX-miR-219 cascade regulates neural stem cell proliferation in neurodevelopment and schizophrenia iPSC model.
26838672 2016 Downregulation of TLX induces TET3 expression and inhibits glioblastoma stem cell self-renewal and tumorigenesis.
26554934 2016 TLX: An elusive receptor.
26280373 2015 Expression profiling of nuclear receptors in breast cancer identifies TLX as a mediator of growth and invasion in triple-negative breast cancer.
26059414 2015 Integrative epigenomic and genomic filtering for methylation markers in hepatocellular carcinomas.
25813674 The relationship between NR2E1 and subclinical inflammation in newly diagnosed type 2 diabetic patients.
25691470 2015 Structural basis for corepressor assembly by the orphan nuclear receptor TLX.
25557355 2015 Orphan nuclear receptor TLX functions as a potent suppressor of oncogene-induced senescence in prostate cancer via its transcriptional co-regulation of the CDKN1A (p21(WAF1) (/) (CIP1) ) and SIRT1 genes.
25356871 2014 TLX activates MMP-2, promotes self-renewal of tumor spheres in neuroblastoma and correlates with poor patient survival.
25328137 2015 The nuclear receptor NR2E1/TLX controls senescence.
More...