Property Summary

NCBI Gene PubMed Count 39
Grant Count 47
R01 Count 38
Funding $9,859,800.69
PubMed Score 44.20
PubTator Score 21.58

Knowledge Summary

Patent (15,849)

Expression

  Differential Expression (7)

Disease log2 FC p
astrocytic glioma -2.600 0.003
posterior fossa group A ependymoma -3.100 0.000
oligodendroglioma -2.100 0.009
medulloblastoma -3.400 0.000
medulloblastoma, large-cell -2.900 0.010
pilocytic astrocytoma -2.300 0.001
subependymal giant cell astrocytoma 3.443 0.027

 GO Component (1)

MLP Assay (2)

AID Type Active / Inconclusive / Inactive Description
2277 screening 14 / 0 / 0 Center Based Initiative to identify novel modulators of the Retinoic acid receptor-related Orphan Receptors (ROR): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors.
504934 other 1 / 0 / 0 Late stage assay provider results from the probe development effort to identify inverse agonists of the liver receptor homolog-1 (LRH-1; NR5A2): luminescence-based high throughput cell-based assay to identify modulators of human nuclear receptors

Gene RIF (31)

PMID Text
26965827 TLX and miR-219 have an important role in both normal neurodevelopment and in schizophrenia patient iPSC-derived NSCs. TLX has a role in regulating microRNA processing, independent of its well-characterized role in transcriptional regulation.
26838672 TLX downregulation induces TET3 expression and inhibits glioblastoma tumorigenesis and self-renewal in glioblastoma stem cells.
26554934 TLX biological role in mental illness and gliomagenesis
26280373 TLX has a role in regulating growth and invasion in ERalpha-negative breast cancer cells
25813674 Increased NR2E1 level may be closely associated with inflammation and disorder of lipid and glucose metabolism in diabetic patients.
25557355 TLX functions as a potent suppressor of oncogene-induced senescence in prostate cancer via its transcriptional co-regulation of the CDKN1A (p21(WAF1) (/) (CIP1) ) and SIRT1 genes
25356871 The effect of TLX on the proliferative, invasive and migratory properties of IMR-32 cells attributed to the recruitment of TLX to both MMP-2 and Oct-4 gene promoters, which resulted in the respective gene activation.
25328137 NR2E1 regulates CBX7 and restrains senescence in neural stem cells.
25327364 These results suggest that let-7b, by forming a negative feedback loop with TLX, provides a novel model to regulate the proliferation and differentiation of retinal progenitors in vitro
23975195 TLX/NR2E1 and related NRs such as PNR and COUPTFs can selectively associate with the developmental corepressor BCL11A via a conserved motif F/YSXXLXXL/Y within the RID1 and RID2 domains. The interaction with BCL11A facilitates TLX-mediated repression of the RARb2 gene.
More...

AA Sequence

MSKPAGSTSRILDIPCKVCGDRSSGKHYGVYACDGCSGFFKRSIRRNRTYVCKSGNQGGCPVDKTHRNQC      1 - 70
RACRLKKCLEVNMNKDAVQHERGPRTSTIRKQVALYFRGHKEENGAAAHFPSAALPAPAFFTAVTQLEPH     71 - 140
GLELAAVSTTPERQTLVSLAQPTPKYPHEVNGTPMYLYEVATESVCESAARLLFMSIKWAKSVPAFSTLS    141 - 210
LQDQLMLLEDAWRELFVLGIAQWAIPVDANTLLAVSGMNGDNTDSQKLNKIISEIQALQEVVARFRQLRL    211 - 280
DATEFACLKCIVTFKAVPTHSGSELRSFRNAAAIAALQDEAQLTLNSYIHTRYPTQPCRFGKLLLLLPAL    281 - 350
RSISPSTIEEVFFKKTIGNVPITRLLSDMYKSSDI                                       351 - 385
//

Text Mined References (40)

PMID Year Title
26965827 2016 The TLX-miR-219 cascade regulates neural stem cell proliferation in neurodevelopment and schizophrenia iPSC model.
26838672 2016 Downregulation of TLX induces TET3 expression and inhibits glioblastoma stem cell self-renewal and tumorigenesis.
26554934 2016 TLX: An elusive receptor.
26280373 2015 Expression profiling of nuclear receptors in breast cancer identifies TLX as a mediator of growth and invasion in triple-negative breast cancer.
26059414 2015 Integrative epigenomic and genomic filtering for methylation markers in hepatocellular carcinomas.
25813674 The relationship between NR2E1 and subclinical inflammation in newly diagnosed type 2 diabetic patients.
25691470 2015 Structural basis for corepressor assembly by the orphan nuclear receptor TLX.
25557355 2015 Orphan nuclear receptor TLX functions as a potent suppressor of oncogene-induced senescence in prostate cancer via its transcriptional co-regulation of the CDKN1A (p21(WAF1) (/) (CIP1) ) and SIRT1 genes.
25356871 2014 TLX activates MMP-2, promotes self-renewal of tumor spheres in neuroblastoma and correlates with poor patient survival.
25328137 2015 The nuclear receptor NR2E1/TLX controls senescence.
More...