Property Summary

NCBI Gene PubMed Count 40
Grant Count 8
R01 Count 5
Funding $484,689.92
PubMed Score 49.49
PubTator Score 50.49

Knowledge Summary

Patent (3,127)

Expression

MLP Assay (4)

AID Type Active / Inconclusive / Inactive Description
1982 other 0 / 0 / 0 Kinase inhibition selectivity assay for compound SID-48409448
488883 summary 29 / 0 / 0 qHTS for Inhibitors of DYRK1B: Summary
504429 confirmatory 57 / 0 / 8 Kinase Inhibition Study on Inhibitors of Dyrk1b (Reaction Biology data)
624046 confirmatory 27 / 1 / 4 Reaction Biology data for inhibitors of DYRK1B: Probe SAR

Gene RIF (18)

PMID Text
26346493 The study shows that DYRK1B is a novel ERK2 substrate, uncovering new links between two kinases involved in cell fate decisions.
25777618 NKX3.1 and DYRK1B were shown to interact via the DYRK1B kinase domain. In vitro kinase assay showed that DYRK1B phosphorylated NKX3.1 at serine 185, a residue critical for NKX3.1 steady-state turnover.
25696812 Data reveal a novel role for miR-9 in regulation of the NFAT pathway by targeting KPNB1 and DYRK1B.
24827035 A founder mutation was identified in DYRK1B, substituting cysteine for arginine at position 102 in 3 families with metabolic syndrome.
24590896 Upregulation of Mirk mRNA expression is mediated by CREB binding to two sites in the Mirk promoter upstream of the transcription start site and one site within exon 4.
24134204 DYRK1B is a novel Thr(286)-CCND1 kinase that acts independently of GSK3beta to promote CCND1 degradation.
22159921 Mirk/Dyrk1B plays an important role in ovarian cancer cell survival through modulating FoxO translocation.
20512148 In line with a redirection of autocrine toward paracrine HH signaling by a KRAS-DYRK1B network, we find high levels of GLI1 expression restricted to the stromal compartment and not to SHH-expressing tumor cells in pancreatic adenocarcinoma.
20042639 the kinase Mirk is essential for the growth and survival of osteosarcoma cells.
19542220 Mirk, through regulating cyclin D turnover, and the CDK inhibitor p27, as shown by depletion studies, functioned independently and additively to regulate the exit of tumor cells from quiescence.
More...

AA Sequence

MAVPPGHGPFSGFPGPQEHTQVLPDVRLLPRRLPLAFRDATSAPLRKLSVDLIKTYKHINEVYYAKKKRR      1 - 70
AQQAPPQDSSNKKEKKVLNHGYDDDNHDYIVRSGERWLERYEIDSLIGKGSFGQVVKAYDHQTQELVAIK     71 - 140
IIKNKKAFLNQAQIELRLLELMNQHDTEMKYYIVHLKRHFMFRNHLCLVFELLSYNLYDLLRNTHFRGVS    141 - 210
LNLTRKLAQQLCTALLFLATPELSIIHCDLKPENILLCNPKRSAIKIVDFGSSCQLGQRIYQYIQSRFYR    211 - 280
SPEVLLGTPYDLAIDMWSLGCILVEMHTGEPLFSGSNEVDQMNRIVEVLGIPPAAMLDQAPKARKYFERL    281 - 350
PGGGWTLRRTKELRKDYQGPGTRRLQEVLGVQTGGPGGRRAGEPGHSPADYLRFQDLVLRMLEYEPAARI    351 - 420
SPLGALQHGFFRRTADEATNTGPAGSSASTSPAPLDTCPSSSTASSISSSGGSSGSSSDNRTYRYSNRYC    421 - 490
GGPGPPITDCEMNSPQVPPSQPLRPWAGGDVPHKTHQAPASASSLPGTGAQLPPQPRYLGRPPSPTSPPP    491 - 560
PELMDVSLVGGPADCSPPHPAPAPQHPAASALRTRMTGGRPPLPPPDDPATLGPHLGLRGVPQSTAASS     561 - 629
//

Text Mined References (42)

PMID Year Title
26346493 2016 Identification of DYRK1B as a substrate of ERK1/2 and characterisation of the kinase activity of DYRK1B mutants from cancer and metabolic syndrome.
25777618 2015 The Tumor Suppressor NKX3.1 Is Targeted for Degradation by DYRK1B Kinase.
25696812 2015 miR-9 enhances the transactivation of nuclear factor of activated T cells by targeting KPNB1 and DYRK1B.
24827035 2014 A form of the metabolic syndrome associated with mutations in DYRK1B.
24590896 2014 Mirk/dyrk1B kinase is upregulated following inhibition of mTOR.
24134204 2014 A novel DYRK1B inhibitor AZ191 demonstrates that DYRK1B acts independently of GSK3? to phosphorylate cyclin D1 at Thr(286), not Thr(288).
23602568 2013 The protein interaction landscape of the human CMGC kinase group.
23114871 2013 Ovarian cancer cells, not normal cells, are damaged by Mirk/Dyrk1B kinase inhibition.
22998443 2012 Selectivity, cocrystal structures, and neuroprotective properties of leucettines, a family of protein kinase inhibitors derived from the marine sponge alkaloid leucettamine B.
22918246 2012 Emerging role of DYRK family protein kinases as regulators of protein stability in cell cycle control.
More...