Property Summary

NCBI Gene PubMed Count 12
PubMed Score 5.17
PubTator Score 6.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
malignant mesothelioma 2.200 0.000
astrocytic glioma 1.900 0.034
ependymoma 2.000 0.006
cutaneous lupus erythematosus -1.600 0.015
psoriasis -4.600 0.000
group 4 medulloblastoma 2.600 0.000
medulloblastoma, large-cell 1.200 0.000
primitive neuroectodermal tumor 1.500 0.000
adrenocortical adenoma 1.701 0.022
non-small cell lung cancer 1.043 0.000
intraductal papillary-mucinous adenoma (... -2.000 0.001
intraductal papillary-mucinous neoplasm ... -3.000 0.003
lung cancer 1.800 0.002
interstitial cystitis -2.400 0.000
cystic fibrosis -1.400 0.013
invasive ductal carcinoma -1.011 0.002
lung carcinoma 2.100 0.000
Pick disease -1.200 0.001
Breast cancer -2.500 0.000
acute myeloid leukemia -1.400 0.036
ovarian cancer -2.100 0.003

Synonym

Accession Q9Y462 B4DSV4 Q6NX42 Q9Y4J6
Symbols ZNF4
ZNF5
ZNF6
CMPX1
MRX97
Zfp711
dJ75N13.1

Gene

Gene RIF (3)

PMID Text
26188516 The KCTD5/cullin3 complex stabilizes ZNF711 transcription factor.
21384559 A total of six novel and 11 known single nucleotide polymorphisms were identified. Further studies are warranted to analyze the candidate genes at Xq11.1-q21.33.
20346720 A functional link between the histone demethylase PHF8 and the transcription factor ZNF711 in X-linked mental retardation is reported.

AA Sequence

MDSGGGSLGLHTPDSRMAHTMIMQDFVAGMAGTAHIDGDHIVVSVPEAVLVSDVVTDDGITLDHGLAAEV      1 - 70
VHGPDIITETDVVTEGVIVPEAVLEADVAIEEDLEEDDGDHILTSELITETVRVPEQVFVADLVTGPNGH     71 - 140
LEHVVQDCVSGVDSPTMVSEEVLVTNSDTETVIQAAGGVPGSTVTIKTEDDDDDDVKSTSEDYLMISLDD    141 - 210
VGEKLEHMGNTPLKIGSDGSQEDAKEDGFGSEVIKVYIFKAEAEDDVEIGGTEIVTESEYTSGHSVAGVL    211 - 280
DQSRMQREKMVYMAVKDSSQEEDDIRDERRVSRRYEDCQASGNTLDSALESRSSTAAQYLQICDGINTNK    281 - 350
VLKQKAKKRRRGETRQWQTAVIIGPDGQPLTVYPCHICTKKFKSRGFLKRHMKNHPDHLMRKKYQCTDCD    351 - 420
FTTNKKVSFHNHLESHKLINKVDKTHEFTEYTRRYREASPLSSNKLILRDKEPKMHKCKYCDYETAEQGL    421 - 490
LNRHLLAVHSKNFPHVCVECGKGFRHPSELKKHMRTHTGEKPYQCQYCIFRCADQSNLKTHIKSKHGNNL    491 - 560
PYKCEHCPQAFGDERELQRHLDLFQGHKTHQCPHCDHKSTNSSDLKRHIISVHTKDFPHKCEVCDKGFHR    561 - 630
PSELKKHSDIHKGRKIHQCRHCDFKTSDPFILSGHILSVHTKDQPLKCKRCKRGFRQQNELKKHMKTHTG    631 - 700
RKIYQCEYCEYSTTDASGFKRHVISIHTKDYPHRCEFCKKGFRRPSEKNQHIMRHHKEALM             701 - 761
//

Text Mined References (13)

PMID Year Title
26188516 2015 Interactions of cullin3/KCTD5 complexes with both cytoplasmic and nuclear proteins: Evidence for a role in protein stabilization.
23376485 2013 Proteomic analysis of podocyte exosome-enriched fraction from normal human urine.
21384559 2011 Fine mapping of Xq11.1-q21.33 and mutation screening of RPS6KA6, ZNF711, ACSL4, DLG3, and IL1RAPL2 for autism spectrum disorders (ASD).
20346720 2010 A functional link between the histone demethylase PHF8 and the transcription factor ZNF711 in X-linked mental retardation.
19377476 2009 A systematic, large-scale resequencing screen of X-chromosome coding exons in mental retardation.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15772651 2005 The DNA sequence of the human X chromosome.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...