Property Summary

NCBI Gene PubMed Count 13
PubMed Score 5.36
PubTator Score 6.35

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (21)

Disease log2 FC p
lung cancer 1.800 1.7e-03
acute myeloid leukemia -1.400 3.6e-02
adrenocortical adenoma 1.701 2.2e-02
astrocytic glioma 1.900 3.4e-02
Breast cancer -2.500 1.9e-05
cutaneous lupus erythematosus -1.600 1.5e-02
cystic fibrosis -1.400 1.3e-02
ependymoma 2.000 6.3e-03
group 4 medulloblastoma 2.600 2.2e-04
interstitial cystitis -2.000 1.7e-03
intraductal papillary-mucinous adenoma (... -2.000 9.8e-04
intraductal papillary-mucinous neoplasm ... -3.000 2.7e-03
invasive ductal carcinoma -1.011 2.1e-03
lung carcinoma 2.100 1.4e-32
malignant mesothelioma 2.200 6.7e-06
medulloblastoma, large-cell 1.200 2.4e-04
non-small cell lung cancer 1.043 2.4e-05
ovarian cancer -2.100 2.7e-03
Pick disease -1.200 5.9e-04
primitive neuroectodermal tumor 1.500 2.1e-04
psoriasis -4.600 6.6e-06

Gene RIF (4)

AA Sequence

MDSGGGSLGLHTPDSRMAHTMIMQDFVAGMAGTAHIDGDHIVVSVPEAVLVSDVVTDDGITLDHGLAAEV      1 - 70
VHGPDIITETDVVTEGVIVPEAVLEADVAIEEDLEEDDGDHILTSELITETVRVPEQVFVADLVTGPNGH     71 - 140
LEHVVQDCVSGVDSPTMVSEEVLVTNSDTETVIQAAGGVPGSTVTIKTEDDDDDDVKSTSEDYLMISLDD    141 - 210
VGEKLEHMGNTPLKIGSDGSQEDAKEDGFGSEVIKVYIFKAEAEDDVEIGGTEIVTESEYTSGHSVAGVL    211 - 280
DQSRMQREKMVYMAVKDSSQEEDDIRDERRVSRRYEDCQASGNTLDSALESRSSTAAQYLQICDGINTNK    281 - 350
VLKQKAKKRRRGETRQWQTAVIIGPDGQPLTVYPCHICTKKFKSRGFLKRHMKNHPDHLMRKKYQCTDCD    351 - 420
FTTNKKVSFHNHLESHKLINKVDKTHEFTEYTRRYREASPLSSNKLILRDKEPKMHKCKYCDYETAEQGL    421 - 490
LNRHLLAVHSKNFPHVCVECGKGFRHPSELKKHMRTHTGEKPYQCQYCIFRCADQSNLKTHIKSKHGNNL    491 - 560
PYKCEHCPQAFGDERELQRHLDLFQGHKTHQCPHCDHKSTNSSDLKRHIISVHTKDFPHKCEVCDKGFHR    561 - 630
PSELKKHSDIHKGRKIHQCRHCDFKTSDPFILSGHILSVHTKDQPLKCKRCKRGFRQQNELKKHMKTHTG    631 - 700
RKIYQCEYCEYSTTDASGFKRHVISIHTKDYPHRCEFCKKGFRRPSEKNQHIMRHHKEALM             701 - 761
//

Text Mined References (15)

PMID Year Title