Property Summary

NCBI Gene PubMed Count 32
PubMed Score 142.07
PubTator Score 73.40

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (6)

Disease Target Count Z-score Confidence
Abruzzo Erickson syndrome 1 0.0 0.0
Cleft palate X-linked 1 0.0 0.0
Disease Target Count P-value
psoriasis 6694 4.3e-04
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 1.0
lung cancer 4740 0.0 0.6

Expression

  Differential Expression (1)

Disease log2 FC p
psoriasis -1.200 4.3e-04

Gene RIF (14)

AA Sequence

MALSSRARAFSVEALVGRPSKRKLQDPIQAEQPELREKKGGEEEEERRSSAAGKSEPLEKQPKTEPSTSA      1 - 70
SSGCGSDSGYGNSSESLEEKDIQMELQGSELWKRFHDIGTEMIITKAGRRMFPSVRVKVKGLDPGKQYHV     71 - 140
AIDVVPVDSKRYRYVYHSSQWMVAGNTDHLCIIPRFYVHPDSPCSGETWMRQIISFDRMKLTNNEMDDKG    141 - 210
HIILQSMHKYKPRVHVIEQGSSVDLSQIQSLPTEGVKTFSFKETEFTTVTAYQNQQITKLKIERNPFAKG    211 - 280
FRDTGRNRGVLDGLLETYPWRPSFTLDFKTFGADTQSGSSGSSPVTSSGGAPSPLNSLLSPLCFSPMFHL    281 - 350
PTSSLGMPCPEAYLPNVNLPLCYKICPTNFWQQQPLVLPAPERLASSNSSQSLAPLMMEVPMLSSLGVTN    351 - 420
SKSGSSEDSSDQYLQAPNSTNQMLYGLQSPGNIFLPNSITPEALSCSFHPSYDFYRYNFSMPSRLISGSN    421 - 490
HLKVNDDSQVSFGEGKCNHVHWYPAINHYL                                            491 - 520
//

Text Mined References (34)

PMID Year Title