Property Summary

NCBI Gene PubMed Count 19
PubMed Score 21.39
PubTator Score 13.06

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Expression

  Differential Expression (7)

Disease log2 FC p
adrenocortical carcinoma 1.251 6.0e-04
Breast cancer 1.500 4.1e-13
group 3 medulloblastoma 1.700 3.9e-05
medulloblastoma, large-cell 1.800 6.7e-06
non-small cell lung cancer 1.557 2.2e-15
ovarian cancer 1.500 1.2e-05
primitive neuroectodermal tumor 1.100 1.1e-03

 GWAS Trait (1)

Gene RIF (10)

AA Sequence

MAAPEAPPLDRVFRTTWLSTECDSHPLPPSYRKFLFETQAADLAGGTTVAAGNLLNESEKDCGQDRRAPG      1 - 70
VQPCRLVTMTSVVKTVYSLQPPSALSGGQPADTQTRATSKSLLPVRSKEVDVSKQLHSGGPENDVTKITK     71 - 140
LRRENGQMKATDTATRRNVRKGYKPLSKQKSEEELKDKNQLLEAVNKQLHQKLTETQGELKDLTQKVELL    141 - 210
EKFRDNCLAILESKGLDPALGSETLASRQESTTDHMDSMLLLETLQEELKLFNETAKKQMEELQALKVKL    211 - 280
EMKEERVRFLEQQTLCNNQVNDLTTALKEMEQLLEM                                      281 - 316
//

Text Mined References (22)

PMID Year Title