Property Summary

NCBI Gene PubMed Count 35
Grant Count 7
R01 Count 3
Funding $439,314.93
PubMed Score 24.33
PubTator Score 27.27

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
malignant mesothelioma 1.700 0.000
esophageal adenocarcinoma -1.900 0.047
psoriasis 2.400 0.000
Atopic dermatitis 1.100 0.001
pancreatic ductal adenocarcinoma liver m... 2.102 0.001
non-small cell lung cancer 1.518 0.000
interstitial cystitis -1.300 0.001
lung adenocarcinoma 1.600 0.000
invasive ductal carcinoma 1.100 0.017
ovarian cancer 1.200 0.000
pituitary cancer -1.300 0.003

Gene RIF (23)

PMID Text
26872154 Children with low 25-hydroxyvitamin D and TMEM16J rs7111432-AA or PKP3 rs10902158-GG polymorphisms were at increased risk for tuberculosis or death.
25972099 Data suggest juxtamembrane regions/domains of desmocollin-2 (DSC2), plakophilin 2 (PKP2), and plakophilin 3 (PKP3) are involved in desmosome formation in epithelial cells; DSC2 participates in desmosome formation in absence of desmoglein 2 (DSG2).
25875355 The results suggest that MMP7 over-expression may be one of the mechanisms by which PKP3 loss leads to increased cell invasion and tumor formation.
25501895 reactive oxygen species (ROS) trigger the c-Src kinase-mediated tyrosine (Tyr)-195 phosphorylation of PKP3.
25225333 cytoplasmic PKP1/3 are components of mRNA ribonucleoprotein particles and act as posttranscriptional regulators of gene expression.
25208567 These findings reveal Pkp3 as a coordinator of desmosome and adherens junction assembly and maturation through its functional association with Rap1.
24328683 Pemphigus vulgaris autoimmune globulin induces Src-dependent tyrosine-phosphorylation of PKP3 and its detachment from DSG3.
24178805 The study describes a new protein variant of the human PKP3 gene, namely PKP3b, which differs from the published PKP3a only at the amino-terminus by the splicing in of the newly identified exon 1b.
24124604 stratifin plays a role in regulating plakophilin-3 incorporation into the desmosomal plaque by forming a plakophilin-3 stratifin complex in the cytosol and thereby affecting desmosome dynamics in squamous epithelial cells.
22701666 Plakophilin3 loss leads to an increase in PRL3 levels promoting K8 dephosphorylation, which is required for transformation and metastasis.
More...

AA Sequence

MQDGNFLLSALQPEAGVCSLALPSDLQLDRRGAEGPEAERLRAARVQEQVRARLLQLGQQPRHNGAAEPE      1 - 70
PEAETARGTSRGQYHTLQAGFSSRSQGLSGDKTSGFRPIAKPAYSPASWSSRSAVDLSCSRRLSSAHNGG     71 - 140
SAFGAAGYGGAQPTPPMPTRPVSFHERGGVGSRADYDTLSLRSLRLGPGGLDDRYSLVSEQLEPAATSTY    141 - 210
RAFAYERQASSSSSRAGGLDWPEATEVSPSRTIRAPAVRTLQRFQSSHRSRGVGGAVPGAVLEPVARAPS    211 - 280
VRSLSLSLADSGHLPDVHGFNSYGSHRTLQRLSSGFDDIDLPSAVKYLMASDPNLQVLGAAYIQHKCYSD    281 - 350
AAAKKQARSLQAVPRLVKLFNHANQEVQRHATGAMRNLIYDNADNKLALVEENGIFELLRTLREQDDELR    351 - 420
KNVTGILWNLSSSDHLKDRLARDTLEQLTDLVLSPLSGAGGPPLIQQNASEAEIFYNATGFLRNLSSASQ    421 - 490
ATRQKMRECHGLVDALVTSINHALDAGKCEDKSVENAVCVLRNLSYRLYDEMPPSALQRLEGRGRRDLAG    491 - 560
APPGEVVGCFTPQSRRLRELPLAADALTFAEVSKDPKGLEWLWSPQIVGLYNRLLQRCELNRHTTEAAAG    561 - 630
ALQNITAGDRRWAGVLSRLALEQERILNPLLDRVRTADHHQLRSLTGLIRNLSRNARNKDEMSTKVVSHL    631 - 700
IEKLPGSVGEKSPPAEVLVNIIAVLNNLVVASPIAARDLLYFDGLRKLIFIKKKRDSPDSEKSSRAASSL    701 - 770
LANLWQYNKLHRDFRAKGYRKEDFLGP                                               771 - 797
//

Text Mined References (44)

PMID Year Title
26872154 2016 Low Vitamin-D Levels Combined with PKP3-SIGIRR-TMEM16J Host Variants Is Associated with Tuberculosis and Death in HIV-Infected and -Exposed Infants.
25972099 2015 Desmocollin-2 alone forms functional desmosomal plaques, with the plaque formation requiring the juxtamembrane region and plakophilins.
25875355 2015 MMP7 is required to mediate cell invasion and tumor formation upon Plakophilin3 loss.
25501895 2015 c-Src mediated tyrosine phosphorylation of plakophilin 3 as a new mechanism to control desmosome composition in cells exposed to oxidative stress.
25468996 2014 E-cadherin interactome complexity and robustness resolved by quantitative proteomics.
25225333 2014 Plakophilins 1 and 3 bind to FXR1 and thereby influence the mRNA stability of desmosomal proteins.
25208567 2014 Plakophilin 3 mediates Rap1-dependent desmosome assembly and adherens junction maturation.
24328683 2014 Pemphigus vulgaris autoimmune globulin induces Src-dependent tyrosine-phosphorylation of plakophilin 3 and its detachment from desmoglein 3.
24178805 2014 An alternative promoter of the human plakophilin-3 gene controls the expression of the new isoform PKP3b.
24129315 2014 Immunoaffinity enrichment and mass spectrometry analysis of protein methylation.
More...