Property Summary

NCBI Gene PubMed Count 36
PubMed Score 25.99
PubTator Score 27.27

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (4)

Expression

  Differential Expression (11)

Disease log2 FC p
Atopic dermatitis 1.100 5.2e-04
esophageal adenocarcinoma -1.900 4.7e-02
interstitial cystitis -1.300 5.9e-04
invasive ductal carcinoma 1.100 1.7e-02
lung adenocarcinoma 1.600 1.2e-08
malignant mesothelioma 1.700 9.1e-07
non-small cell lung cancer 1.377 6.8e-15
ovarian cancer 1.200 1.8e-08
pancreatic ductal adenocarcinoma liver m... 2.102 7.8e-04
pituitary cancer -1.300 3.2e-03
psoriasis 2.400 2.4e-06

Gene RIF (24)

AA Sequence

MQDGNFLLSALQPEAGVCSLALPSDLQLDRRGAEGPEAERLRAARVQEQVRARLLQLGQQPRHNGAAEPE      1 - 70
PEAETARGTSRGQYHTLQAGFSSRSQGLSGDKTSGFRPIAKPAYSPASWSSRSAVDLSCSRRLSSAHNGG     71 - 140
SAFGAAGYGGAQPTPPMPTRPVSFHERGGVGSRADYDTLSLRSLRLGPGGLDDRYSLVSEQLEPAATSTY    141 - 210
RAFAYERQASSSSSRAGGLDWPEATEVSPSRTIRAPAVRTLQRFQSSHRSRGVGGAVPGAVLEPVARAPS    211 - 280
VRSLSLSLADSGHLPDVHGFNSYGSHRTLQRLSSGFDDIDLPSAVKYLMASDPNLQVLGAAYIQHKCYSD    281 - 350
AAAKKQARSLQAVPRLVKLFNHANQEVQRHATGAMRNLIYDNADNKLALVEENGIFELLRTLREQDDELR    351 - 420
KNVTGILWNLSSSDHLKDRLARDTLEQLTDLVLSPLSGAGGPPLIQQNASEAEIFYNATGFLRNLSSASQ    421 - 490
ATRQKMRECHGLVDALVTSINHALDAGKCEDKSVENAVCVLRNLSYRLYDEMPPSALQRLEGRGRRDLAG    491 - 560
APPGEVVGCFTPQSRRLRELPLAADALTFAEVSKDPKGLEWLWSPQIVGLYNRLLQRCELNRHTTEAAAG    561 - 630
ALQNITAGDRRWAGVLSRLALEQERILNPLLDRVRTADHHQLRSLTGLIRNLSRNARNKDEMSTKVVSHL    631 - 700
IEKLPGSVGEKSPPAEVLVNIIAVLNNLVVASPIAARDLLYFDGLRKLIFIKKKRDSPDSEKSSRAASSL    701 - 770
LANLWQYNKLHRDFRAKGYRKEDFLGP                                               771 - 797
//

Text Mined References (45)

PMID Year Title