Property Summary

NCBI Gene PubMed Count 1
PubMed Score 0.40
PubTator Score 0.33

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
osteosarcoma 7950 7.5e-06
Disease Target Count Z-score Confidence
Retinitis pigmentosa 3 16 4.369 2.2

AA Sequence

MTTQEDTTGLHQKTSLWTMSRPGAKKVMNSYFIAGCGPAVCYYAVSWLRQGFSINLTSFGRIPWPHAGVG      1 - 70
TCPSPQSWISPFLQSHREHHYAKTSSHSQPSPQSLALCLAYSRCSINICQMTECISLASGCHQALREPGR     71 - 140
SEESFWIPATPYISNIFSES                                                      141 - 160
//

Text Mined References (2)

PMID Year Title