Property Summary

NCBI Gene PubMed Count 6
PubMed Score 0.67
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease Sources (3)

Disease Target Count
Down syndrome 548
Muscle Weakness 92
Disease Target Count P-value
group 4 medulloblastoma 1875 0.00128095301085188
breast carcinoma 1614 0.00166294077887116
ductal carcinoma in situ 1745 0.00337811449665693
invasive ductal carcinoma 2950 0.0049251255969828
psoriasis 6685 0.00551014390268949
astrocytoma 1493 0.0200241661330904
fibroadenoma 557 0.0410611898824498
Disease Target Count
tuberculosis 1563

Expression

  Differential Expression (8)

Disease log2 FC p
tuberculosis 1.200 0.000
psoriasis -1.200 0.006
astrocytoma 1.400 0.020
breast carcinoma -1.200 0.002
fibroadenoma -1.600 0.041
group 4 medulloblastoma -1.300 0.001
ductal carcinoma in situ -1.500 0.003
invasive ductal carcinoma -1.800 0.005

Synonym

Accession Q9Y426 Q5R2V7 Q6AHX8 Q9NSE6
Symbols TMEM24L
C21orf25
C21orf258

Gene

  Ortholog (13)

Species Source
Chimp OMA EggNOG
Macaque OMA EggNOG Inparanoid
Mouse OMA EggNOG Inparanoid
Rat OMA EggNOG Inparanoid
Dog OMA EggNOG
Horse OMA EggNOG Inparanoid
Cow OMA EggNOG Inparanoid
Pig OMA EggNOG Inparanoid
Opossum OMA Inparanoid
Platypus OMA EggNOG Inparanoid
Chicken OMA EggNOG Inparanoid
Anole lizard OMA Inparanoid
Xenopus OMA EggNOG

Gene RIF (1)

PMID Text
20494980 The C2CD2/C21orf25 promoter is activated by Trichostatin A (TSA) treatment and by serum depletion according to promoter reporter assays in HEK 293 cells.

AA Sequence

MAMARLGSWLGEAQWLALVSLFVAALATVGLYLAQWALARARPQPQRRAVEPGEGPRPGSDALLSWILTL      1 - 70
GSWRSQWQAAWVTALNEEAERKGGPPFLSFEEDPRQQALELVVQEVSSVLRSAEEKVVVCHVVGQAIQFL     71 - 140
VSETPALGAGCRLYDMRLSPFHLQLEFHMKEKREDLQISWSFISVPEMAVNIQPKALGEDQVAETSAMSD    141 - 210
VLKDILKHLAGSASPSVVLITKPTTVKEAQNLQCAASTAQESCPPKPPRAHELKLLVRNIHVLLLSEPGA    211 - 280
SGHINAVCVVQLNDPVQRFSSTLTKNTPDLMWEEEFTFELNAKSKELHLQISEAGRSSEGLLATATVPLD    281 - 350
LFKKQPSGPQSFTLTSGSACGSSVLGSVTAEFSYMEPGELKSWPIPPPVPAAKIEKDRTVMPCGTVVTTV    351 - 420
TAVKTKPRVDVGRASPLSSDSPVKTPIKVKVIEKDISVQAIACRSAPVSKTLSSSDTELLVLNGSDPVAE    421 - 490
VAIRQLSESSKLKLKSPRKKSTIIISGISKTSLSQDHDAALMQGYTASVDSTHQEDAPSHPERAAASAPP    491 - 560
EEAESAQASLAPKPQEDELDSWDLEKEPQAAAWSSQVLLDPDGDELSESSMSVLEPGTAKKHKGGILRKG    561 - 630
AKLFFRRRHQQKDPGMSQSHNDLVFLEQPEGSRRKGITLTRILNKKLLSRHRNKNTMNGAPVEPCT        631 - 696
//

Text Mined References (10)

PMID Year Title
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
24057671 2014 Genome-wide association study of ancestry-specific TB risk in the South African Coloured population.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
20494980 2010 Functional analysis and identification of cis-regulatory elements of human chromosome 21 gene promoters.
18669648 2008 A quantitative atlas of mitotic phosphorylation.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
16780588 2006 Cell array-based intracellular localization screening reveals novel functional features of human chromosome 21 proteins.
15289880 2004 Identification and characterization of TMEM24 family genes in silico.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
10830953 2000 The DNA sequence of human chromosome 21.