Property Summary

NCBI Gene PubMed Count 6
PubMed Score 1.17
PubTator Score 1.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 1.5e-06
group 4 medulloblastoma 1855 1.3e-03
breast carcinoma 1638 1.7e-03
ductal carcinoma in situ 1745 3.4e-03
invasive ductal carcinoma 2951 4.9e-03
astrocytoma 1146 2.0e-02
fibroadenoma 559 4.1e-02
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.6
Disease Target Count
tuberculosis 2010

Expression

  Differential Expression (8)

Disease log2 FC p
tuberculosis 1.200 1.9e-05
astrocytoma 1.400 2.0e-02
breast carcinoma -1.200 1.7e-03
ductal carcinoma in situ -1.500 3.4e-03
fibroadenoma -1.600 4.1e-02
group 4 medulloblastoma -1.300 1.3e-03
invasive ductal carcinoma -1.800 4.9e-03
psoriasis -1.100 1.5e-06

Gene RIF (1)

AA Sequence

MAMARLGSWLGEAQWLALVSLFVAALATVGLYLAQWALARARPQPQRRAVEPGEGPRPGSDALLSWILTL      1 - 70
GSWRSQWQAAWVTALNEEAERKGGPPFLSFEEDPRQQALELVVQEVSSVLRSAEEKVVVCHVVGQAIQFL     71 - 140
VSETPALGAGCRLYDMRLSPFHLQLEFHMKEKREDLQISWSFISVPEMAVNIQPKALGEDQVAETSAMSD    141 - 210
VLKDILKHLAGSASPSVVLITKPTTVKEAQNLQCAASTAQESCPPKPPRAHELKLLVRNIHVLLLSEPGA    211 - 280
SGHINAVCVVQLNDPVQRFSSTLTKNTPDLMWEEEFTFELNAKSKELHLQISEAGRSSEGLLATATVPLD    281 - 350
LFKKQPSGPQSFTLTSGSACGSSVLGSVTAEFSYMEPGELKSWPIPPPVPAAKIEKDRTVMPCGTVVTTV    351 - 420
TAVKTKPRVDVGRASPLSSDSPVKTPIKVKVIEKDISVQAIACRSAPVSKTLSSSDTELLVLNGSDPVAE    421 - 490
VAIRQLSESSKLKLKSPRKKSTIIISGISKTSLSQDHDAALMQGYTASVDSTHQEDAPSHPERAAASAPP    491 - 560
EEAESAQASLAPKPQEDELDSWDLEKEPQAAAWSSQVLLDPDGDELSESSMSVLEPGTAKKHKGGILRKG    561 - 630
AKLFFRRRHQQKDPGMSQSHNDLVFLEQPEGSRRKGITLTRILNKKLLSRHRNKNTMNGAPVEPCT        631 - 696
//

Text Mined References (10)

PMID Year Title