Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.66
PubTator Score 2.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
astrocytic glioma 1.100 1.4e-02
Astrocytoma, Pilocytic 1.100 5.3e-04
atypical teratoid / rhabdoid tumor 1.700 1.9e-04
group 3 medulloblastoma 1.200 9.0e-04
lung carcinoma -1.400 1.5e-21
malignant mesothelioma -3.500 1.7e-07
medulloblastoma, large-cell 1.300 2.0e-02
osteosarcoma 2.003 2.1e-04
primitive neuroectodermal tumor 1.400 1.9e-05

Protein-protein Interaction (3)

Gene RIF (2)

AA Sequence

MPAENSPAPAYKVSSHGGDSGLDGLGGPGVQLGSPDKKKRKANTQGPSFPPLSEYAPPPNPNSDHLVAAN      1 - 70
PFDDNYNTISYKPLPSSNPYLGPGYPGFGGYSTFRMPPHVPPRMSSPYCGPYSLRNQPHPFPQNPLGMGF     71 - 140
NRPHAFNFGPHDNSSFGNPSYNNALSQNVNMPNQHFRQNPAENFSQIPPQNASQVSNPDLASNFVPGNNS    141 - 210
NFTSPLESNHSFIPPPNTFGQAKAPPPKQDFTQGATKNTNQNSSAHPPHLNMDDTVNQSNIELKNVNRNN    211 - 280
AVNQENSRSSSTEATNNNPANGTQNKPRQPRGAADACTTEKSNKSSLHPNRHGHSSSDPVYPCGICTNEV    281 - 350
NDDQDAILCEASCQKWFHRICTGMTETAYGLLTAEASAVWGCDTCMADKDVQLMRTRETFGPSAVGSDA     351 - 419
//

Text Mined References (9)

PMID Year Title