Property Summary

NCBI Gene PubMed Count 6
PubMed Score 2.66
PubTator Score 2.33

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (9)

Disease log2 FC p
malignant mesothelioma -3.500 0.000
astrocytic glioma 1.100 0.014
osteosarcoma 2.653 0.001
group 4 medulloblastoma 2.000 0.000
atypical teratoid / rhabdoid tumor 1.700 0.000
medulloblastoma, large-cell 1.300 0.020
primitive neuroectodermal tumor 1.400 0.000
pilocytic astrocytoma 1.100 0.000
lung carcinoma -1.400 0.000

Synonym

Accession Q9Y3Y4 A7Y2D6
Symbols

Gene

PDB

2VP7   2VPB   2VPD   2VPE   2VPG  

Gene RIF (2)

PMID Text
20403915 Observational study of gene-disease association. (HuGE Navigator)
18498752 Data show that human and Drosophila Pygo PHD fingers associate with their cognate HD1 domains from BCL9/Legless to bind specifically to the histone H3 tail methylated at lysine 4 (H3K4me).

AA Sequence

MPAENSPAPAYKVSSHGGDSGLDGLGGPGVQLGSPDKKKRKANTQGPSFPPLSEYAPPPNPNSDHLVAAN      1 - 70
PFDDNYNTISYKPLPSSNPYLGPGYPGFGGYSTFRMPPHVPPRMSSPYCGPYSLRNQPHPFPQNPLGMGF     71 - 140
NRPHAFNFGPHDNSSFGNPSYNNALSQNVNMPNQHFRQNPAENFSQIPPQNASQVSNPDLASNFVPGNNS    141 - 210
NFTSPLESNHSFIPPPNTFGQAKAPPPKQDFTQGATKNTNQNSSAHPPHLNMDDTVNQSNIELKNVNRNN    211 - 280
AVNQENSRSSSTEATNNNPANGTQNKPRQPRGAADACTTEKSNKSSLHPNRHGHSSSDPVYPCGICTNEV    281 - 350
NDDQDAILCEASCQKWFHRICTGMTETAYGLLTAEASAVWGCDTCMADKDVQLMRTRETFGPSAVGSDA     351 - 419
//

Text Mined References (9)

PMID Year Title
20403915 2010 Single nucleotide polymorphisms in Wnt signaling and cell death pathway genes and susceptibility to colorectal cancer.
18498752 2008 Decoding of methylated histone H3 tail by the Pygo-BCL9 Wnt signaling complex.
17974005 2007 The full-ORF clone resource of the German cDNA Consortium.
17113272 2007 BCL9-2 binds Arm/beta-catenin in a Tyr142-independent manner and requires Pygopus for its function in Wg/Wnt signaling.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
14612447 2004 Pygopus residues required for its binding to Legless are critical for transcription and development.
11988739 2002 A new nuclear component of the Wnt signalling pathway.
11955446 2002 Wnt/wingless signaling requires BCL9/legless-mediated recruitment of pygopus to the nuclear beta-catenin-TCF complex.