Property Summary

NCBI Gene PubMed Count 19
PubMed Score 13.22
PubTator Score 7.89

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (11)

Disease log2 FC p
group 3 medulloblastoma 1.700 1.3e-03
intraductal papillary-mucinous neoplasm ... 1.100 2.7e-03
lung adenocarcinoma 1.200 2.8e-17
lung cancer 1.200 3.8e-04
malignant mesothelioma 1.200 1.2e-06
Multiple myeloma 1.172 1.7e-02
osteosarcoma -1.191 6.4e-05
ovarian cancer 1.900 2.0e-04
psoriasis -1.600 5.9e-04
subependymal giant cell astrocytoma -1.448 1.0e-02
Waldenstrons macroglobulinemia 1.125 2.7e-02

Gene RIF (7)

AA Sequence

MAAQSAPKVVLKSTTKMSLNERFTNMLKNKQPTPVNIRASMQQQQQLASARNRRLAQQMENRPSVQAALK      1 - 70
LKQSLKQRLGKSNIQARLGRPIGALARGAIGGRGLPIIQRGLPRGGLRGGRATRTLLRGGMSLRGQNLLR     71 - 140
GGRAVAPRMGLRRGGVRGRGGPGRGGLGRGAMGRGGIGGRGRGMIGRGRGGFGGRGRGRGRGRGALARPV    141 - 210
LTKEQLDNQLDAYMSKTKGHLDAELDAYMAQTDPETND                                    211 - 248
//

Text Mined References (25)

PMID Year Title