Property Summary

NCBI Gene PubMed Count 18
PubMed Score 11.42
PubTator Score 7.89

Knowledge Summary


No data available


  Differential Expression (11)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.125 0.027
Multiple myeloma 1.172 0.017
malignant mesothelioma 1.200 0.000
psoriasis -1.600 0.001
osteosarcoma -1.656 0.000
intraductal papillary-mucinous neoplasm ... 1.100 0.003
lung cancer 1.200 0.000
group 3 medulloblastoma 1.700 0.001
subependymal giant cell astrocytoma -1.448 0.010
lung adenocarcinoma 1.200 0.000
ovarian cancer 1.900 0.000


Accession Q9Y3Y2 D3DV55 Q0VAQ8 Q2VPI9 Q5T7Y8 Q5T7Y9 Q5T7Z0 Q6NSM4 Q6PB28 Q8WYT9 Q9BUC5 Q9H034 Q9H2L0
Symbols FOP


Gene RIF (6)

25284789 Results suggest that 5hmC plays a critical role in glioblastomagenesis by recruiting the CHTOP-methylosome complex to selective sites on the chromosome, where it methylates H4R3 and activates the transcription of cancer-related genes.
23826332 a spatial map is produced in living cells of the sites for the interaction of two TREX subunits, Alyref and Chtop, with Nxf1.
23299939 Chtop is a component of the dynamic TREX mRNA export complex that, along with Alyref, activates the ATPase and RNA helicase activities of Uap56.
20688955 The recently identified chromatin factor Friend of Prmt1 (FOP) is a critical modulator of gamma-globin gene expression.
19858291 Fop is tightly associated with chromatin, and that it is modified by both asymmetric and symmetric arginine methylation in vivo. Fop plays an important role in the ligand-dependent activation of estrogen receptor target genes, including TFF1 (pS2).
19254951 The reduction in SRAG protein that occurs in proliferating cells was mapped with inhibitors to the G(2)/M phase of the cell cycle. As expected, the overexpression of SRAG reduced the percentage of cells in the G(2)/M phase and increased cell death.

AA Sequence

LTKEQLDNQLDAYMSKTKGHLDAELDAYMAQTDPETND                                    211 - 248

Text Mined References (23)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
25284789 2014 5-Hydroxymethylcytosine plays a critical role in glioblastomagenesis by recruiting the CHTOP-methylosome complex.
23826332 2013 Mapping interactions between mRNA export factors in living cells.
23299939 2013 Chtop is a component of the dynamic TREX mRNA export complex.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
22681889 2012 The mRNA-bound proteome and its global occupancy profile on protein-coding transcripts.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
21269460 2011 Initial characterization of the human central proteome.
20688955 2010 Fetal globin expression is regulated by Friend of Prmt1.