Property Summary

NCBI Gene PubMed Count 20
PubMed Score 10.89
PubTator Score 7.51

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

Gene RIF (10)

AA Sequence

MAEPVQEELSVLAAIFCRPHEWEVLSRSETDGTVFRIHTKAEGFMDVDIPLELVFHLPVNYPSCLPGISI      1 - 70
NSEQLTRAQCVTVKENLLEQAESLLSEPMVHELVLWIQQNLRHILSQPETGSGSEKCTFSTSTTMDDGLW     71 - 140
ITLLHLDHMRAKTKYVKIVEKWASDLRLTGRLMFMGKIILILLQGDRNNLKEYLILQKTSKVDVDSSGKK    141 - 210
CKEKMISVLFETKVQTEHKRFLAFEVKEYSALDELQKEFETAGLKKLFSEFVLALVK                 211 - 267
//

Text Mined References (22)

PMID Year Title