Property Summary

NCBI Gene PubMed Count 19
PubMed Score 10.90
PubTator Score 7.51

Knowledge Summary

Patent

No data available

TINX Plot

Expression

Gene RIF (9)

PMID Text
26297826 an important role of RSUME in cancer and inflammation
25549536 the present report suggest that the association of RWDD3 and TECTA with paclitaxel-induced peripheral neuropathy may have been a false positive signal
25500545 RSUME is expressed in VHL tumors and inhibits VHL and regulates its tumor suppressor function.
23508108 RSUME interacts with glucocorticoid receptor and increases its SUMOylation and transcriptional activity, pointing to SUMO conjugation as the cause for transcriptional stimulation.
23469069 a degree of redundancy of the RSUME variants on the SUMO pathway
22877241 this study failed to replicate a GWAS reporting an association between the 2 SNPs rs2296308 in RWDD3 and rs1829 in the intron of TECTA and time to neuropathy in ovarian cancer patients treated with paclitaxel
22009797 RSUME critically regulates HIF-1a and VEGF-A production and thus might play an important role in pituitary tumour neovascularisation
19407504 BMP-4 and RSUME may be interesting targets for inhibiting steps involved in pituitary tumorigenesis.
17956732 RSUME plays a central role in the regulation of sumoylation and, hence, several critical regulatory pathways in mammalian cells [RSUME].

AA Sequence

MAEPVQEELSVLAAIFCRPHEWEVLSRSETDGTVFRIHTKAEGFMDVDIPLELVFHLPVNYPSCLPGISI      1 - 70
NSEQLTRAQCVTVKENLLEQAESLLSEPMVHELVLWIQQNLRHILSQPETGSGSEKCTFSTSTTMDDGLW     71 - 140
ITLLHLDHMRAKTKYVKIVEKWASDLRLTGRLMFMGKIILILLQGDRNNLKEYLILQKTSKVDVDSSGKK    141 - 210
CKEKMISVLFETKVQTEHKRFLAFEVKEYSALDELQKEFETAGLKKLFSEFVLALVK                 211 - 267
//

Publication (21)

PMID Year Title
26297826 2015 Role of RSUME in inflammation and cancer.
25918163 2015 RWD Domain as an E2 (Ubc9)-Interaction Module.
25549536 2015 RWDD3 and TECTA variants not linked to paclitaxel induced peripheral neuropathy in North American trial Alliance N08C1.
25500545 2015 RSUME inhibits VHL and regulates its tumor suppressor function.
23508108 2013 RSUME enhances glucocorticoid receptor SUMOylation and transcriptional activity.
23469069 2013 In silico structural and functional characterization of the RSUME splice variants.
23362303 2013 Genome-wide association study identifies novel loci associated with concentrations of four plasma phospholipid fatty acids in the de novo lipogenesis pathway: results from the Cohorts for Heart and Aging Research in Genomic Epidemiology (CHARGE) consortium.
22877241 2013 GWAS-based association between RWDD3 and TECTA variants and paclitaxel induced neuropathy could not be confirmed in Scandinavian ovarian cancer patients.
22009797 2012 RSUME is implicated in HIF-1-induced VEGF-A production in pituitary tumour cells.
19407504 2009 Differential gene expression in models of pituitary prolactin-producing tumoral cells.
More...