Property Summary

NCBI Gene PubMed Count 25
Grant Count 6
R01 Count 6
Funding $310,542.2
PubMed Score 39.12
PubTator Score 16.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Gene RIF (1)

PMID Text
22029674 RPL36 may be involved in the early stage of hepatocarcinogenesis, and it can be used as an independent and potential prognostic marker for resected hepatocellular carcinoma.

AA Sequence

MALRYPMAVGLNKGHKVTKNVSKPRHSRRRGRLTKHTKFVRDMIREVCGFAPYERRAMELLKVSKDKRAL      1 - 70
KFIKKRVGTHIRAKRKREELSNVLAAMRKAAAKKD                                        71 - 105
//

Text Mined References (30)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
23636399 2013 Structures of the human and Drosophila 80S ribosome.
22658674 2012 Insights into RNA biology from an atlas of mammalian mRNA-binding proteins.
22029674 2011 RPL36 as a prognostic marker in hepatocellular carcinoma.
21269460 2011 Initial characterization of the human central proteome.
20562859 2010 Network organization of the human autophagy system.
19946888 2010 Defining the membrane proteome of NK cells.
19608861 2009 Lysine acetylation targets protein complexes and co-regulates major cellular functions.
19061985 2008 Ribosomal protein L5 and L11 mutations are associated with cleft palate and abnormal thumbs in Diamond-Blackfan anemia patients.
18029348 2008 Toward a confocal subcellular atlas of the human proteome.
More...