Property Summary

NCBI Gene PubMed Count 25
PubMed Score 39.86
PubTator Score 16.41

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (7)

Disease log2 FC p
acute quadriplegic myopathy 1.127 3.1e-04
intraductal papillary-mucinous neoplasm ... -1.300 1.3e-02
lung cancer -2.500 4.7e-02
medulloblastoma, large-cell 1.300 1.8e-04
Multiple myeloma 1.941 2.7e-03
ovarian cancer -1.200 1.5e-04
sonic hedgehog group medulloblastoma 1.500 3.1e-06

Gene RIF (1)

AA Sequence

MALRYPMAVGLNKGHKVTKNVSKPRHSRRRGRLTKHTKFVRDMIREVCGFAPYERRAMELLKVSKDKRAL      1 - 70
KFIKKRVGTHIRAKRKREELSNVLAAMRKAAAKKD                                        71 - 105
//

Text Mined References (31)

PMID Year Title