Property Summary

NCBI Gene PubMed Count 3
PubMed Score 0.05

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Disease Target Count P-value
intraductal papillary-mucinous neoplasm (IPMN) 3291 1.9e-03
Disease Target Count Z-score Confidence
Carcinosarcoma 7 3.808 1.9

Expression

  Differential Expression (1)

Disease log2 FC p
intraductal papillary-mucinous neoplasm ... -1.300 1.9e-03

Synonym

Accession Q9Y3T6 B7ZLI1
Symbols

Gene

  Ortholog (1)

Species Source Disease
Macaque OMA Inparanoid

Gene RIF (2)

AA Sequence

MALLCLDGVFLSSAENDFVHRIQEELDRFLLQKQLSKVLLFPPLSSRLRYLIHRTAENFDLLSSFSVGEG      1 - 70
WKRRTVICHQDIRVPSSDGLSGPCRAPASCPSRYHGPRPISNQGAAAVPRGARAGRWYRGRKPDQPLYVP     71 - 140
RVLRRQEEWGLTSTSVLKREAPAGRDPEEPGDVGAGDPNSDQGLPVLMTQGTEDLKGPGQRCENEPLLDP    141 - 210
VGPEPLGPESQSGKGDMVEMATRFGSTLQLDLEKGKESLLEKRLVAEEEEDEEEVEEDGPSSCSEDDYSE    211 - 280
LLQEITDNLTKKEIQIEKIHLDTSSFVEELPGEKDLAHVVEIYDFEPALKTEDLLATFSEFQEKGFRIQW    281 - 350
VDDTHALGIFPCLASAAEALTREFSVLKIRPLTQGTKQSKLKALQRPKLLRLVKERPQTNATVARRLVAR    351 - 420
ALGLQHKKKERPAVRGPLPP                                                      421 - 440
//

Text Mined References (8)

PMID Year Title