Property Summary

NCBI Gene PubMed Count 12
PubMed Score 3.06
PubTator Score 4.83

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (8)

Disease log2 FC p
Waldenstrons macroglobulinemia 1.404 0.001
Multiple myeloma 1.602 0.001
malignant mesothelioma -1.300 0.000
psoriasis 1.600 0.000
glioblastoma 1.300 0.008
medulloblastoma, large-cell 1.200 0.001
ovarian cancer -2.700 0.000
dermatomyositis 1.700 0.001

Synonym

Accession Q9Y3S2 B2RDA3
Symbols NOA36
HSA6591

Gene

Gene RIF (2)

PMID Text
23516598 NOA36 protein contains a highly conserved nucleolar localization signal capable of directing functional proteins to the nucleolus, in mammalian cells.
19895853 NOA36/ZNF330 is translocated from the mitochondria to the cytoplasm when apoptosis is induced and that it contributes to cytochrome c release.

AA Sequence

MPKKKTGARKKAENRREREKQLRASRSTIDLAKHPCNASMECDKCQRRQKNRAFCYFCNSVQKLPICAQC      1 - 70
GKTKCMMKSSDCVIKHAGVYSTGLAMVGAICDFCEAWVCHGRKCLSTHACACPLTDAECVECERGVWDHG     71 - 140
GRIFSCSFCHNFLCEDDQFEHQASCQVLEAETFKCVSCNRLGQHSCLRCKACFCDDHTRSKVFKQEKGKQ    141 - 210
PPCPKCGHETQETKDLSMSTRSLKFGRQTGGEEGDGASGYDAYWKNLSSDKYGDTSYHDEEEDEYEAEDD    211 - 280
EEEEDEGRKDSDTESSDLFTNLNLGRTYASGYAHYEEQEN                                  281 - 320
//

Text Mined References (16)

PMID Year Title
23516598 2013 NOA36 protein contains a highly conserved nucleolar localization signal capable of directing functional proteins to the nucleolus, in mammalian cells.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
22814378 2012 N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB.
21269460 2011 Initial characterization of the human central proteome.
20585324 2011 Genome-wide association study of conduct disorder symptomatology.
19895853 2009 NOA36/ZNF330 is a conserved cystein-rich protein with proapoptotic activity in human cells.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
16344560 2006 Diversification of transcriptional modulation: large-scale identification and characterization of putative alternative promoters of human genes.
15592455 2005 Immunoaffinity profiling of tyrosine phosphorylation in cancer cells.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
More...