Property Summary

NCBI Gene PubMed Count 12
PubMed Score 3.06
PubTator Score 4.83

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (2)

Expression

  Differential Expression (8)

Disease log2 FC p
dermatomyositis 1.700 7.8e-04
glioblastoma 1.300 8.0e-03
malignant mesothelioma -1.300 3.9e-06
medulloblastoma, large-cell 1.200 5.6e-04
Multiple myeloma 1.602 8.3e-04
ovarian cancer -2.700 3.4e-06
psoriasis 1.600 8.2e-05
Waldenstrons macroglobulinemia 1.404 1.3e-03

Gene RIF (2)

AA Sequence

MPKKKTGARKKAENRREREKQLRASRSTIDLAKHPCNASMECDKCQRRQKNRAFCYFCNSVQKLPICAQC      1 - 70
GKTKCMMKSSDCVIKHAGVYSTGLAMVGAICDFCEAWVCHGRKCLSTHACACPLTDAECVECERGVWDHG     71 - 140
GRIFSCSFCHNFLCEDDQFEHQASCQVLEAETFKCVSCNRLGQHSCLRCKACFCDDHTRSKVFKQEKGKQ    141 - 210
PPCPKCGHETQETKDLSMSTRSLKFGRQTGGEEGDGASGYDAYWKNLSSDKYGDTSYHDEEEDEYEAEDD    211 - 280
EEEEDEGRKDSDTESSDLFTNLNLGRTYASGYAHYEEQEN                                  281 - 320
//

Text Mined References (16)

PMID Year Title