Property Summary

NCBI Gene PubMed Count 19
Grant Count 16
R01 Count 11
Funding $1,390,655.49
PubMed Score 125.55
PubTator Score 47.00

Knowledge Summary


No data available


  Disease Relevance (3)

Gene RIF (13)

26193330 cytosolic GBA3 is likely involved in the catabolism of cytosolic sialyl free N-glycans, possibly by stabilizing the activity of the NEU2 protein
25033330 Circular dichroism (CD) spectra at variable temperatures have been recorded for human cytosolic sialidase NEU2 in buffered water solutions and in the presence of divalent cations.
23908028 Q136K is a novel mutation in an expressed NEU2 protein that was discovered during crystallographic analysis.
23068092 the present study demonstrated NEU2 expression to be detectable but very low in many human tissues and cells, and suggested possible functional roles in PC-3 prostate cancer cells.
22228546 NEU2 appears to be activated when lysine 45 and glutamine 112 are mutated to alanine.
20800603 Observational study of gene-disease association. (HuGE Navigator)
19524683 Neu2 loss of expression might exacerbate the defective myogenic differentiation of rhabdomyosarcoma cells.
17426694 propose that this Asian-enriched sialidase variation caused by the SNP, likely in homozygous form, may be associated with certain severe adverse reactions to oseltamivir
15501818 the first high resolution x-ray structures of sialidase, human Neu2
14613940 HsNEU2 differentially recognizes the type of sialosyl linkage, the aglycone part of the substrate, and the supramolecular organization (monomer/micelle/vesicle) of gangliosides

AA Sequence

GCLYEANDYEEIVFLMFTLKQAFPAEYLPQ                                            351 - 380

Text Mined References (20)

PMID Year Title
26193330 2015 Co-Expression of NEU2 and GBA3 Causes a Drastic Reduction in Cytosolic Sialyl Free N-glycans in Human MKN45 Stomach Cancer Cells-Evidence for the Physical Interaction of NEU2 and GBA3.
25416956 2014 A proteome-scale map of the human interactome network.
25033330 2014 Looking at human cytosolic sialidase NEU2 structural features with an interdisciplinary approach.
24152035 2014 Variants in the 1q21 risk region are associated with a visual endophenotype of autism and schizophrenia.
23908028 2013 Preliminary crystallographic analysis of neuraminidase N2 from a new influenza A virus.
23068092 2012 Human cytosolic sialidase NEU2-low general tissue expression but involvement in PC-3 prostate cancer cell survival.
22228546 2012 Molecular insight into substrate recognition by human cytosolic sialidase NEU2.
20800603 2010 Investigation of genetic susceptibility factors for human longevity - a targeted nonsynonymous SNP study.
19524683 2009 Defective myogenic differentiation of human rhabdomyosarcoma cells is characterized by sialidase Neu2 loss of expression.
17426694 2007 A nonsynonymous SNP in human cytosolic sialidase in a small Asian population results in reduced enzyme activity: potential link with severe adverse reactions to oseltamivir.