Property Summary

NCBI Gene PubMed Count 21
PubMed Score 129.50
PubTator Score 47.00

Knowledge Summary

Patent

No data available

TINX Plot

  Disease (3)

Disease Target Count P-value
psoriasis 6694 5.3e-80
Disease Target Count Z-score Confidence
Carcinoma 11493 0.0 0.5

PDB (16)

Gene RIF (13)

AA Sequence

MASLPVLQKESVFQSGAHAYRIPALLYLPGQQSLLAFAEQRASKKDEHAELIVLRRGDYDAPTHQVQWQA      1 - 70
QEVVAQARLDGHRSMNPCPLYDAQTGTLFLFFIAIPGQVTEQQQLQTRANVTRLCQVTSTDHGRTWSSPR     71 - 140
DLTDAAIGPAYREWSTFAVGPGHCLQLHDRARSLVVPAYAYRKLHPIQRPIPSAFCFLSHDHGRTWARGH    141 - 210
FVAQDTLECQVAEVETGEQRVVTLNARSHLRARVQAQSTNDGLDFQESQLVKKLVEPPPQGCQGSVISFP    211 - 280
SPRSGPGSPAQWLLYTHPTHSWQRADLGAYLNPRPPAPEAWSEPVLLAKGSCAYSDLQSMGTGPDGSPLF    281 - 350
GCLYEANDYEEIVFLMFTLKQAFPAEYLPQ                                            351 - 380
//

Text Mined References (22)

PMID Year Title