Property Summary

NCBI Gene PubMed Count 16
PubMed Score 2.49
PubTator Score 9.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytic glioma 1.100 6.1e-03
atypical teratoid / rhabdoid tumor -1.600 3.7e-04
group 3 medulloblastoma -1.600 3.4e-04
medulloblastoma, large-cell -2.300 1.4e-06
pituitary cancer -1.200 5.9e-04
subependymal giant cell astrocytoma -1.056 4.1e-02

Gene RIF (2)

AA Sequence

MSGGKKKSSFQITSVTTDYEGPGSPGASDPPTPQPPTGPPPRLPNGEPSPDPGGKGTPRNGSPPPGAPSS      1 - 70
RFRVVKLPHGLGEPYRRGRWTCVDVYERDLEPHSFGGLLEGIRGASGGAGGRSLDSRLELASLGLGAPTP     71 - 140
PSGLSQGPTSWLRPPPTSPGPQARSFTGGLGQLVVPSKAKAEKPPLSASSPQQRPPEPETGESAGTSRAA    141 - 210
TPLPSLRVEAEAGGSGARTPPLSRRKAVDMRLRMELGAPEEMGQVPPLDSRPSSPALYFTHDASLVHKSP    211 - 280
DPFGAVAAQKFSLAHSMLAISGHLDSDDDSGSGSLVGIDNKIEQAMDLVKSHLMFAVREEVEVLKEQIRE    281 - 350
LAERNAALEQENGLLRALASPEQLAQLPSSGVPRLGPPAPNGPSV                             351 - 395
//

Text Mined References (26)

PMID Year Title