Property Summary

NCBI Gene PubMed Count 15
Grant Count 11
R01 Count 9
Funding $1,963,315.02
PubMed Score 2.49
PubTator Score 9.70

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (6)

Disease log2 FC p
astrocytic glioma 1.100 0.006
group 4 medulloblastoma -2.600 0.000
atypical teratoid/rhabdoid tumor -2.100 0.000
medulloblastoma, large-cell -2.300 0.000
subependymal giant cell astrocytoma -1.056 0.041
pituitary cancer -1.200 0.001

Gene RIF (2)

PMID Text
21059936 tRNA(His) guanylyltransferase (THG1), a unique 3'-5' nucleotidyl transferase, shares unexpected structural homology with canonical 5'-3' DNA polymerases.
20149264 Long form of TSC22DF is evolutionarily conserved and has growth-regulating potential.

AA Sequence

MSGGKKKSSFQITSVTTDYEGPGSPGASDPPTPQPPTGPPPRLPNGEPSPDPGGKGTPRNGSPPPGAPSS      1 - 70
RFRVVKLPHGLGEPYRRGRWTCVDVYERDLEPHSFGGLLEGIRGASGGAGGRSLDSRLELASLGLGAPTP     71 - 140
PSGLSQGPTSWLRPPPTSPGPQARSFTGGLGQLVVPSKAKAEKPPLSASSPQQRPPEPETGESAGTSRAA    141 - 210
TPLPSLRVEAEAGGSGARTPPLSRRKAVDMRLRMELGAPEEMGQVPPLDSRPSSPALYFTHDASLVHKSP    211 - 280
DPFGAVAAQKFSLAHSMLAISGHLDSDDDSGSGSLVGIDNKIEQAMDLVKSHLMFAVREEVEVLKEQIRE    281 - 350
LAERNAALEQENGLLRALASPEQLAQLPSSGVPRLGPPAPNGPSV                             351 - 395
//

Text Mined References (25)

PMID Year Title
25416956 2014 A proteome-scale map of the human interactome network.
24275569 2014 An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.
23186163 2013 Toward a comprehensive characterization of a human cancer cell phosphoproteome.
21988832 2011 Toward an understanding of the protein interaction network of the human liver.
21516116 2011 Next-generation sequencing to generate interactome datasets.
21269460 2011 Initial characterization of the human central proteome.
21059936 2010 tRNA(His) guanylyltransferase (THG1), a unique 3'-5' nucleotidyl transferase, shares unexpected structural homology with canonical 5'-3' DNA polymerases.
20149264 2010 Madm (Mlf1 adapter molecule) cooperates with Bunched A to promote growth in Drosophila.
20068231 2010 Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis.
19690332 2009 Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions.
More...