Property Summary

NCBI Gene PubMed Count 8
Grant Count 2
Funding $628,921.5
PubMed Score 7.21
PubTator Score 87.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
Multiple myeloma 1.501 0.006
glioblastoma 1.600 0.001
atypical teratoid / rhabdoid tumor -1.100 0.000
medulloblastoma, large-cell -1.100 0.000
primitive neuroectodermal tumor -1.100 0.000
lung cancer 1.500 0.007
fibroadenoma 1.400 0.031
adult high grade glioma -1.100 0.004
lung adenocarcinoma 1.221 0.000
ductal carcinoma in situ 1.900 0.000
invasive ductal carcinoma 1.600 0.003
ovarian cancer 2.600 0.000

Synonym

Accession Q9Y3Q3 A8K069 B4DN05 Q2T9F8
Symbols p26
P24B
p24g4
C15orf22

Gene

 Grant Application (2)

Gene RIF (2)

PMID Text
24920608 This genome-wide screen has identified two novel metastatic suppressors: TMED3 and SOX12, the knockdown of which increases metastatic growth after direct seeding.
22761906 AIM1, ERGIC1, and TPX2 were shown to be highly expressed especially in prostate cancer tissues, and high mRNA expression of ERGIC1 and TMED3 associated with AR and ERG oncogene expression

AA Sequence

MGSTVPRSASVLLLLLLLRRAEQPCGAELTFELPDNAKQCFHEEVEQGVKFSLDYQVITGGHYDVDCYVE      1 - 70
DPQGNTIYRETKKQYDSFTYRAEVKGVYQFCFSNEFSTFSHKTVYFDFQVGDEPPILPDMGNRVTALTQM     71 - 140
ESACVTIHEALKTVIDSQTHYRLREAQDRARAEDLNSRVSYWSVGETIALFVVSFSQVLLLKSFFTEKRP    141 - 210
ISRAVHS                                                                   211 - 217
//

Text Mined References (13)

PMID Year Title
25944712 2015 N-terminome analysis of the human mitochondrial proteome.
24920608 2014 A novel genome-wide in vivo screen for metastatic suppressors in human colon cancer identifies the positive WNT-TCF pathway modulators TMED3 and SOX12.
22761906 2012 High-throughput transcriptomic and RNAi analysis identifies AIM1, ERGIC1, TMED3 and TPX2 as potential drug targets in prostate cancer.
16940185 2006 Coatomer, the coat protein of COPI transport vesicles, discriminates endoplasmic reticulum residents from p24 proteins.
16572171 2006 Analysis of the DNA sequence and duplication history of human chromosome 15.
15489334 2004 The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC).
15342556 2004 Sequence comparison of human and mouse genes reveals a homologous block structure in the promoter regions.
14702039 2004 Complete sequencing and characterization of 21,243 full-length human cDNAs.
12975309 2003 The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment.
12477932 2002 Generation and initial analysis of more than 15,000 full-length human and mouse cDNA sequences.
More...