Property Summary

NCBI Gene PubMed Count 8
PubMed Score 7.21
PubTator Score 87.20

Knowledge Summary

Patent

No data available

Expression

  Differential Expression (12)

Disease log2 FC p
adult high grade glioma -1.100 4.3e-03
atypical teratoid / rhabdoid tumor -1.100 6.1e-07
ductal carcinoma in situ 1.900 1.8e-04
fibroadenoma 1.400 3.1e-02
glioblastoma 1.600 9.0e-04
invasive ductal carcinoma 1.600 3.1e-03
lung adenocarcinoma 1.221 2.0e-08
lung cancer 1.500 7.4e-03
medulloblastoma, large-cell -1.100 3.9e-04
Multiple myeloma 1.501 5.5e-03
ovarian cancer 2.600 4.8e-06
primitive neuroectodermal tumor -1.100 7.0e-05

Protein-protein Interaction (6)

Gene RIF (2)

AA Sequence

MGSTVPRSASVLLLLLLLRRAEQPCGAELTFELPDNAKQCFHEEVEQGVKFSLDYQVITGGHYDVDCYVE      1 - 70
DPQGNTIYRETKKQYDSFTYRAEVKGVYQFCFSNEFSTFSHKTVYFDFQVGDEPPILPDMGNRVTALTQM     71 - 140
ESACVTIHEALKTVIDSQTHYRLREAQDRARAEDLNSRVSYWSVGETIALFVVSFSQVLLLKSFFTEKRP    141 - 210
ISRAVHS                                                                   211 - 217
//

Text Mined References (13)

PMID Year Title